Recombinant Human Microfibril-Associated Glycoprotein 4, MFAP4(C-6His)

Contact us
Catalog number: CI81
Price: 369 €
Supplier: novo
Product name: Recombinant Human Microfibril-Associated Glycoprotein 4, MFAP4(C-6His)
Quantity: 50 µg
Other quantities: 10 µg 100€ 50 µg 202€ 500 µg 780€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human MFAP4 is produced by our Mammalian expression system and the target gene encoding Val22-Ala255 is expressed with a 6His tag at the C-terminus
Molecular Weight: 27, 5 kD
UniProt number: P55083
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGVGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRAVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MFAP4(C-6His), Microfibril-Associated Glycoprotein 4
Short name: MFAP4(C-6His), Recombinant Microfibril-Associated Glycoprotein 4
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: microfibrillar-associated protein 4(C-6His), sapiens Microfibril-Associated Glycoprotein 4, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, MFAP4 and IDBG-34759 and ENSG00000166482 and 4239, MFAP4 and IDBG-637769 and ENSBTAG00000006187 and 286766, Mfap4 and IDBG-183000 and ENSMUSG00000042436 and 76293, protein binding, this GO :0001527 and microfibril and cellular component this GO :0003674 and molecular function and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0007155 and cell adhesion and biological process this GO :0009650 and UV protection and biological process this GO :0010712 and regulation of collagen metabolic process and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0043206 and extracellular fibril organization and biological process this GO :0048251 and elastic fiber assembly and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071493 and cellular response to UV-B and biological process this GO :0071953 and elastic fiber and cellular component, this GO :0003674 : molecular_function, this GO :0003674 : molecular_function and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, microfibrillar-associated protein 4
Identity: 7035
Gene: MFAP4 | More about : MFAP4
Long gene name: microfibrillar associated protein 4
Synonyms name: microfibril-associated glycoprotein 4
Locus: 17p11, 2
Discovery year: 1994-11-17
GenBank acession: L38486
Entrez gene record: 4239
Pubmed identfication: 7633408
RefSeq identity: NM_002404
Classification: Fibrinogen C domain containing
Havana BLAST/BLAT: OTTHUMG00000059585

Related Products :

CI81 Recombinant Human Microfibril-Associated Glycoprotein 4, MFAP4(C-6His) 50 µg 202 € novo human
MBS624095 MAGP2, CT (Microfibril-associated Glycoprotein 2, MAGP-2, Microfibrillar-associated Protein 5, MFAP5, MFAP-5, MP25) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS613985 MAGP1 (Microfibril-associated glycoprotein-1) Antibody 0.25 ml 630 € MBS Polyclonals_1 human
abx166207 Anti-Elastin Microfibril Interface Located Protein 1 (Recombinant) 50 μg 644 € abbex human
abx166210 Anti-Elastin Microfibril Interface Located Protein 1 (Recombinant) 100 μg 876 € abbex human
MBS611761 Podoplanin (PDPN, Aggrus, Glycoprotein 36kD, Glycoprotein 36, gp36, GP38, HT1A-1, hT1alpha1, hT1alpha2, Lung Type-I Cell Membrane-associated Glycoprotein Isoform a, OTS8, OTS-8, PA2.26 Antigen, T1 alpha, T1A, TIA2) 100ug 696 € MBS Polyclonals_1 human
C897 Recombinant Human Myelin-Associated Glycoprotein, MAG, Siglec-4a (C-6His) 50 µg 369 € novo human
CS82 Recombinant Mouse Lysosome-associated Membrane Glycoprotein 1, LAMP-1, CD107a (C-6His) 1 mg 1877 € novo mouse
abx252388 Anti-Human Elastin Microfibril Interface Located Protein 1 ELISA Kit 96 tests 557 € abbex human
abx190412 Anti-Human Elastin Microfibril Interface Located Protein 2 CLIA Kit inquire 50 € abbex human
DL-EMILIN1-Hu Human Elastin Microfibril Interface Located Protein 1 EMILIN1 ELISA Kit 96T 846 € DL elisas human
DL-EMILIN2-Hu Human Elastin Microfibril Interface Located Protein 2 EMILIN2 ELISA Kit 96T 904 € DL elisas human
abx128700 Anti-Elastin Microfibril Interface Located Protein 1 Antibody 50 μg 383 € abbex human
abx130245 Anti-Elastin Microfibril Interface Located Protein 1 Antibody 100 μg 514 € abbex human
GENTAUR-58bdd6abdac03 Anti- Elastin Microfibril Interface Located Protein 1 (EMILIN1) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd7037e306 Anti- Elastin Microfibril Interface Located Protein 1 (EMILIN1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd771d95c0 Anti- Elastin Microfibril Interface Located Protein 1 (EMILIN1) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdd7724d86e Anti- Elastin Microfibril Interface Located Protein 1 (EMILIN1) Antibody 50ug 359 € MBS Polyclonals human
abx254056 Anti-Mouse Elastin Microfibril Interface Located Protein 1 ELISA Kit 96 tests 557 € abbex mouse
abx190600 Anti-Mouse Elastin Microfibril Interface Located Protein 2 CLIA Kit inquire 50 € abbex mouse
EKU03855 Elastin Microfibril Interface Located Protein 1 (EMILIN1) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU03856 Elastin Microfibril Interface Located Protein 2 (EMILIN2) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU03857 Elastin Microfibril Interface Located Protein 2 (EMILIN2) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
DL-EMILIN2-Mu Mouse Elastin Microfibril Interface Located Protein 2 EMILIN2 ELISA Kit 96T 921 € DL elisas mouse
MBS622089 BAIAP2 (Brain-specific Angiogenesis Inhibitor 1-associated Protein 2, BAI1-associated Protein 2, BAI-associated Protein 2, BAP2, Fas Ligand-associated Factor 3, FLAF3, Insulin Receptor Substrate Protein of 53kD, Insulin Receptor Substrate p53, IRSP53, Ins Antibody 100ug 763 € MBS Polyclonals_1 human
CD54 Recombinant Human α-1-Acid Glycoprotein 2, AGP2, ORM2 (C-6His) 500 µg 1613 € novo human
C425 Recombinant Human Fetuin-A, AHSG, α-2-HS-Glycoprotein, AHSG (C-6His) 50 µg 273 € novo human
C474 Recombinant Human Glycoprotein A33, GPA33, GPA33 (C-6His) 50 µg 369 € novo human
CD80 Recombinant Human Leucine-Rich α-2-Glycoprotein, LRG1 (C-6His) 50 µg 339 € novo human
CB74 Recombinant Human Leucine-Rich α-2-Glycoprotein, LRG1 (C-Fc-6His) 50 µg 369 € novo human