| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human LRG1 is produced by our Mammalian expression system and the target gene encoding Val36-Gln347 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
3 kD, 35 |
| UniProt number: |
P02750 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
20 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM Tris, 5, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
LRG1 (C-6His), -2-Glycoprotein, Leucine-Rich &alpha |
| Short name: |
LRG1 (C-6His), -2-Glycoprotein, Recombinant Leucine-Rich &alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
leucine-rich alpha-2-glycoprotein 1 (C-6His), sapiens Leucine-Rich &alpha, -2-Glycoprotein, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, LRG1 and IDBG-19050 and ENSG00000171236 and 116844, LRG1 and IDBG-644250 and ENSBTAG00000031647 and 514663, Lrg1 and IDBG-191684 and ENSMUSG00000037095 and 76905, protein binding, this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0003674 and molecular function and molecular function this GO :0005160 and transforming growth factor beta receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0008150 and biological process and biological process this GO :0016020 and membrane and cellular component this GO :0030511 and positive regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0050873 and brown fat cell differentiation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003674 : molecular_function, this GO :0003674 : molecular_function and also this GO :0005160 : transforming growth factor beta receptor binding and also this GO :0005515 : protein binding, this GO :0005160 : transforming growth factor beta receptor binding, this GO :0005515 : protein binding, leucine-rich alpha-2-glycoprotein 1 |
| Identity: |
29480 |
| Gene: |
LRG1 |
More about : LRG1 |
| Long gene name: |
leucine rich alpha-2-glycoprotein 1 |
| Synonyms: |
LRG |
| Synonyms name: |
leucine rich alpha 2 glycoprotein |
| Locus: |
19p13, 3 |
| Discovery year: |
2004-02-12 |
| Entrez gene record: |
116844 |
| Pubmed identfication: |
3856868 12223515 |
| RefSeq identity: |
NM_052972 |
| Havana BLAST/BLAT: |
OTTHUMG00000182010 |