Recombinant Human α-Amylase 2B, AMY2B (C-6His)

Contact us
Catalog number: CI36
Price: 2283 €
Supplier: novo
Product name: Recombinant Human α-Amylase 2B, AMY2B (C-6His)
Quantity: 1 mg
Other quantities: 1 mg 2283€ 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human alpha-amylase 2B is produced by our Mammalian expression system and the target gene encoding Gln16-Leu511 is expressed with a 6His tag at the C-terminus
Molecular Weight: 56, 9 kD
UniProt number: P19961
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: AMY2B (C-6His), &alpha, -Amylase 2B
Short name: AMY2B (C-6His), -Amylase 2B, Recombinant &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: AMY2B (C-6His), sapiens &alpha, -Amylase 2B, recombinant H
Alternative technique: rec
Identity: 478
Gene: AMY2B | More about : AMY2B
Long gene name: alpha 2B (pancreatic) , amylase
Synonyms gene: AMY2
Synonyms gene name: alpha 2B, amylase, pancreatic
Locus: 1p21, 1
Discovery year: 1988-08-19
GenBank acession: M24895
Entrez gene record: 280
Pubmed identfication: 8268204
RefSeq identity: NM_020978
Havana BLAST/BLAT: OTTHUMG00000011024

Related Products :

MBS623584 Amylase, Salivary (alpha-Amylase, AMY1, Amylase alpha 1A Salivary, Amylase Salivary alpha 1A, AMY1A, Amylase alpha 1B Salivary, Amylase Salivary alpha 1B, AMY1B, Amylase alpha 1C Salivary, Amylase Salivary alpha 1C, AMY1C, 1,4-alpha-D-glucan Glucanohydrol Antibody 1 mililiter 779 € MBS Polyclonals_1 human
CI36 Recombinant Human α-Amylase 2B, AMY2B (C-6His) 50 µg 303 € novo human
AP50167PU-N anti-Alpha-amylase 2B / AMY2B (N-term) Antibody 0,4 ml 587 € acr human
LV074281 AMY2B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV074282 AMY2B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV074283 AMY2B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV074284 AMY2B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV074286 AMY2B Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV074285 AMY2B Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GWB-MW422H AMY2B antibody 1 vial 521 € genways human
GWB-MW423I AMY2B antibody 1 vial 521 € genways human
GWB-3186C4 AMY2B Over-expression Lysate reagent 1 x 1 vial 463 € genways human
GENTAUR-58bdecbac5f00 Anti- AMY2B Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdecbb3fbce Anti- AMY2B Antibody 0.06 ml 265 € MBS Polyclonals human
abx907427 Anti-AMY2B siRNA 30 nmol 717 € abbex human
RP-0070H Recombinant Human AMY2A / Alpha-amylase Protein(His Tag) 50μg 624 € adv human
C682 Recombinant Human α-N-Acetylneuraminide α-2,8-Sialyltransferase, ST8SIA1 (C-6His) 500 µg 1613 € novo human
C275 Recombinant Human α-Soluble NSF Attachment Protein, SNAP-α, NAPA (N-6His) 50 µg 496 € novo human
MBS619394 Spectrin, alpha (Spectrin alpha Chain, Spectrin alpha Chain Brain, Spectrin Non-erythroid alpha Chain, Alpha Fodrin, Alpha II Spectrin, FLJ44613, Fodrin alpha Chain, Non-erythrocytic Spectrin alpha, Spectrin alpha Non-erythrocytic 1, SPTAN1, SPTA2) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS620094 T-Complex Protein 1 alpha (T Complex Protein 1 alpha Subunit, T Complex Protein 1 Subunit alpha, TCP1 alpha, TCP1-alpha, TCP-1 alpha, CCT 1, CCT1, CCT alpha, CCTa, D6S230E, T Complex 1, T-complex 1, T Complex Locus TCP1, T-complex Locus TCP-1, T Complex P 100ug 735 € MBS Polyclonals_1 human
MBS622864 Tubulin, alpha, Detyrosinated (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) Antibody 50ug 1089 € MBS Polyclonals_1 human
abx167405 Anti-Amylase alpha 2, Pancreatic Protein (Recombinant) 10 μg 412 € abbex human
RP-1012RC Recombinant Rhesus AMY2A / Alpha-amylase Protein (Fc Tag) 20μg 572 € adv rhesus
RP-1011RC Recombinant Rhesus AMY2A / Alpha-amylase Protein (His Tag) 20μg 572 € adv rhesus
CD54 Recombinant Human α-1-Acid Glycoprotein 2, AGP2, ORM2 (C-6His) 500 µg 1613 € novo human
C956 Recombinant Human Alpha 1-Microglobulin, AMBP (C-6His) 50 µg 303 € novo human
C118 Recombinant Human α B Crystallin Chain, CRYAB (C-6His) 1 mg 2283 € novo human
CF01 Recombinant Human α-Crystallin A Chain, CRYAA (C-6His) 1 mg 1014 € novo human
CS71 Recombinant Human Alpha-Fetoprotein, AFP (C-6His) 500 µg 1613 € novo human
C351 Recombinant Human α-Galactosidase, GLA (C-6His) 1 mg 2283 € novo human