| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
AMBP (C-6His) is a &alpha, - or alpha protein sometimes glycoprotein present in blood, The Recombinant Alpha 1-Microglobulin |
| Molecular Weight: |
21, 9 kD |
| UniProt number: |
P02760 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
AMBP (C-6His), Alpha 1-Microglobulin |
| Short name: |
AMBP (C-6His), Recombinant Alpha 1-Microglobulin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
alpha-1-microglobulin/bikunin precursor (C-6His), sapiens a 1-Microglobulin, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
A1M and EDC1 and HCP and HI30 and IATIL and ITI and ITIL and ITILC and UTI, AMBP and IDBG-638444 and ENSBTAG00000015676 and 280996, AMBP and IDBG-81952 and ENSG00000106927 and 259, Ambp and IDBG-154074 and ENSMUSG00000028356 and 11699, Extracellular, calcium oxalate binding, this GO :0004867 and serine-type endopeptidase inhibitor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007565 and female pregnancy and biological process this GO :0009986 and cell surface and cellular component this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0016032 and viral process and biological process this GO :0018298 and protein-chromophore linkage and biological process this GO :0019855 and calcium channel inhibitor activity and molecular function this GO :0019862 and IgA binding and molecular function this GO :0020037 and heme binding and molecular function this GO :0030163 and protein catabolic process and biological process this GO :0036094 and small molecule binding and molecular function this GO :0042167 and heme catabolic process and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0046329 and negative regulation of JNK cascade and biological process this GO :0046904 and calcium oxalate binding and molecular function this GO :0050777 and negative regulation of immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component, this GO :0004867 : serine-type endopeptidase inhibitor activity, this GO :0004867 : serine-type endopeptidase inhibitor activity and also this GO :0005515 : protein binding and also this GO :0019855 : calcium channel inhibitor activity and also this GO :0019862 : IgA binding and also this GO :0020037 : heme binding and also this GO :0036094 : small molecule binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046904 : calcium oxalate binding, this GO :0005515 : protein binding, this GO :0019855 : calcium channel inhibitor activity, this GO :0019862 : IgA binding, this GO :0020037 : heme binding, this GO :0036094 : small molecule binding, this GO :0042803 : protein homodimerization activity, this GO :0046904 : calcium oxalate binding, alpha-1-microglobulin/bikunin precursor |
| Identity: |
453 |
| Gene: |
AMBP |
More about : AMBP |
| Long gene name: |
alpha-1-microglobulin/bikunin precursor |
| Synonyms gene: |
ITI ITIL |
| Synonyms: |
UTI HCP EDC1 HI30 IATIL ITILC |
| Synonyms name: |
growth-inhibiting protein 19 uristatin complex-forming glycoprotein heterogeneous in charge bikunin inter-alpha-trypsin inhibitor light chain protein HC uronic-acid-rich protein trypstatin |
| Locus: |
9q32 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
X04494 |
| Entrez gene record: |
259 |
| Pubmed identfication: |
1708673 1385302 |
| RefSeq identity: |
NM_001633 |
| Classification: |
Lipocalins |
| Havana BLAST/BLAT: |
OTTHUMG00000020534 |