| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human alpha-Crystallin A Chain is produced by our E, coli expression system and the target gene encoding Met1-Ser173 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
20, 9 kD |
| UniProt number: |
P02489 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 mM EDTA, pH 8, 2 um filtered solution of phosphate buffered saline, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSSLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CRYAA (C-6His), &alpha, -Crystallin A Chain |
| Short name: |
CRYAA (C-6His), -Crystallin A Chain, Recombinant &alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
alpha A (C-6His), crystallin, sapiens &alpha, -Crystallin A epitope, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CRYAA and IDBG-4699 and ENSG00000160202 and 102724652, CRYAA and IDBG-639603 and ENSBTAG00000003134 and 281718, Cryaa and IDBG-164758 and ENSMUSG00000024041 and 12954, alpha A, nuclei, this GO :0005212 and structural constituent of eye lens and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0007601 and visual perception and biological process this GO :0032387 and negative regulation of intracellular transport and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0046872 and metal ion binding and molecular function this GO :0051082 and unfolded protein binding and molecular function this GO :0051260 and protein homooli this GO merization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005212 : structural constituent of eye lens, this GO :0005212 : structural constituent of eye lens and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0046872 : metal ion binding and also this GO :0051082 : unfolded protein binding, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, this GO :0046872 : metal ion binding, this GO :0051082 : unfolded protein binding, unfolded protein binding, 1409, crystallin |
| Identity: |
2388 |
| Gene: |
CRYAA |
More about : CRYAA |
| Long gene name: |
crystallin alpha A |
| Synonyms gene: |
CRYA1 |
| Synonyms gene name: |
alpha A , crystallin |
| Synonyms: |
HSPB4 |
| Locus: |
21q22, 3 |
| Discovery year: |
1986-01-01 |
| Entrez gene record: |
1409 |
| Classification: |
Small heat shock proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000086842 |
| Locus Specific Databases: |
LOVD - Leiden Open Variation Database |