Recombinant Human Ribonuclease T2, RNASET2 (C-6His)

Catalog number:	CI28 Buy Now
Price:	50 €
Supplier:	abbex
Product name:	Recombinant Human Ribonuclease T2, RNASET2 (C-6His)
Quantity:	inquire
Other quantities:	10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:	human rnaset sapiens chis identity produced

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Ribonuclease T2 is produced by our Mammalian expression system and the target gene encoding Asp25-His256 is expressed with a 6His tag at the C-terminus
Molecular Weight:	2 kD, 28
UniProt number:	O00584
State of the product:	Liquid
Shipping conditions:	Dry ice/ice packs
Formulation:	150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHcl, 20%Glycerol, 5, Supplied as a 0, pH7
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHVDHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	RNASET2 (C-6His), Ribonuclease T2
Short name:	RNASET2 (C-6His), Recombinant Ribonuclease T2
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	RNASET2 (C-6His), sapiens Ribonuclease T2, recombinant H
Alternative technique:	rec
Identity:	21686
Gene:	RNASET2 | More about : RNASET2
Long gene name:	ribonuclease T2
Synonyms:	RNASE6PL FLJ10907 bA514O12, 3
Locus:	6q27
Discovery year:	2003-11-26
GenBank acession:	AJ419866
Entrez gene record:	8635
Pubmed identfication:	9192857
RefSeq identity:	NM_003730
Havana BLAST/BLAT:	OTTHUMG00000016009

• #human
• #rnaset
• #sapiens
• #chis
• #identity
• #produced