Recombinant Human Ribonuclease T2, RNASET2 (C-6His)

Contact us
Catalog number: CI28
Price: 50 €
Supplier: abbex
Product name: Recombinant Human Ribonuclease T2, RNASET2 (C-6His)
Quantity: inquire
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Ribonuclease T2 is produced by our Mammalian expression system and the target gene encoding Asp25-His256 is expressed with a 6His tag at the C-terminus
Molecular Weight: 2 kD, 28
UniProt number: O00584
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHcl, 20%Glycerol, 5, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: RNASET2 (C-6His), Ribonuclease T2
Short name: RNASET2 (C-6His), Recombinant Ribonuclease T2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: RNASET2 (C-6His), sapiens Ribonuclease T2, recombinant H
Alternative technique: rec
Identity: 21686
Gene: RNASET2 | More about : RNASET2
Long gene name: ribonuclease T2
Synonyms: RNASE6PL FLJ10907 bA514O12, 3
Locus: 6q27
Discovery year: 2003-11-26
GenBank acession: AJ419866
Entrez gene record: 8635
Pubmed identfication: 9192857
RefSeq identity: NM_003730
Havana BLAST/BLAT: OTTHUMG00000016009

Related Products :

CI28 Recombinant Human Ribonuclease T2, RNASET2 (C-6His) 1 mg 2486 € novo human
abx570181 Anti-Human Ribonuclease T2 (RNASET2) ELISA Kit 96 tests 731 € abbex human
GENTAUR-58bc517dccd83 Human Ribonuclease T2 (RNASET2) 100ug 1696 € MBS Recombinant Proteins human
GENTAUR-58bc517e2e2f1 Human Ribonuclease T2 (RNASET2) 1000ug 1696 € MBS Recombinant Proteins human
GENTAUR-58bc517e819e9 Human Ribonuclease T2 (RNASET2) 100ug 2210 € MBS Recombinant Proteins human
GENTAUR-58bc517ed71de Human Ribonuclease T2 (RNASET2) 1000ug 2210 € MBS Recombinant Proteins human
DL-RNASET2-Hu Human Ribonuclease T2 RNASET2 ELISA Kit 96T 846 € DL elisas human
abx572176 Anti-Mouse Ribonuclease T2 (RNASET2) ELISA Kit 96 tests 746 € abbex mouse
abx572177 Anti-Rat Ribonuclease T2 (RNASET2) ELISA Kit inquire 50 € abbex rat
GENTAUR-58bdc59821f99 Anti- Ribonuclease T2 (RNASET2) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdcb5dba1b5 Anti- Ribonuclease T2 (RNASET2) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcb5e403a6 Anti- Ribonuclease T2 (RNASET2) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdda34e15ab Anti- Ribonuclease T2 (RNASET2) Antibody 100ug 520 € MBS Polyclonals human
DL-RNASET2-Mu Mouse Ribonuclease T2 RNASET2 ELISA Kit 96T 869 € DL elisas mouse
DL-RNASET2-Ra Rat Ribonuclease T2 RNASET2 ELISA Kit 96T 904 € DL elisas rat
EKU07128 Ribonuclease T2 (RNASET2) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU07129 Ribonuclease T2 (RNASET2) ELISA kit 1 plate of 96 wells 764 € Biomatik ELISA kits human
EKU07130 Ribonuclease T2 (RNASET2) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
RP-1324H Recombinant Human RNASET2 Protein (His Tag) 10μg 624 € adv human
MBS248602 Anti-Human RNASET2 50ug 597 € MBS Polyclonals_1 human
LV288855 RNASET2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdf55cd078a Anti- RNASET2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf55d5de55 Anti- RNASET2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be115036a24 Anti- RNASET2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be11508b4f4 Anti- RNASET2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be4cceb443b Anti- RNASET2 Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be4ccf17f41 Anti- RNASET2 Antibody 0.2 mg 558 € MBS Polyclonals human
AP55670CP-N anti-RNASET2 (C-term) Control Peptide Antibody 50 Вµg 282 € acr human
AP53699PU-N anti-RNASET2 (N-term) Antibody 0,4 ml 587 € acr human
abx931646 Anti-RNASET2 siRNA inquire 50 € abbex human