| Catalog number: | CI28 |
|---|---|
| Price: | 50 € |
| Supplier: | abbex |
| Product name: | Recombinant Human Ribonuclease T2, RNASET2 (C-6His) |
| Quantity: | inquire |
| Other quantities: | 1 mg 2486€ 10 µg 202€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Ribonuclease T2 is produced by our Mammalian expression system and the target gene encoding Asp25-His256 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 2 kD, 28 |
| UniProt number: | O00584 |
| State of the product: | Liquid |
| Shipping conditions: | Dry ice/ice packs |
| Formulation: | 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHcl, 20%Glycerol, 5, Supplied as a 0, pH7 |
| Storage recommendations: | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHVDHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | RNASET2 (C-6His), Ribonuclease T2 |
| Short name: | RNASET2 (C-6His), Recombinant Ribonuclease T2 |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | RNASET2 (C-6His), sapiens Ribonuclease T2, recombinant H |
| Alternative technique: | rec |
| Identity: | 21686 |
| Gene: | RNASET2 | More about : RNASET2 |
| Long gene name: | ribonuclease T2 |
| Synonyms: | RNASE6PL FLJ10907 bA514O12, 3 |
| Locus: | 6q27 |
| Discovery year: | 2003-11-26 |
| GenBank acession: | AJ419866 |
| Entrez gene record: | 8635 |
| Pubmed identfication: | 9192857 |
| RefSeq identity: | NM_003730 |
| Havana BLAST/BLAT: | OTTHUMG00000016009 |
| CI28 | Recombinant Human Ribonuclease T2, RNASET2 (C-6His) | 1 mg | 2486 € | novo | human |
| abx570181 | Anti-Human Ribonuclease T2 (RNASET2) ELISA Kit | 96 tests | 731 € | abbex | human |
| GENTAUR-58bc517dccd83 | Human Ribonuclease T2 (RNASET2) | 100ug | 1696 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc517e2e2f1 | Human Ribonuclease T2 (RNASET2) | 1000ug | 1696 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc517e819e9 | Human Ribonuclease T2 (RNASET2) | 100ug | 2210 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc517ed71de | Human Ribonuclease T2 (RNASET2) | 1000ug | 2210 € | MBS Recombinant Proteins | human |
| DL-RNASET2-Hu | Human Ribonuclease T2 RNASET2 ELISA Kit | 96T | 846 € | DL elisas | human |
| abx572176 | Anti-Mouse Ribonuclease T2 (RNASET2) ELISA Kit | 96 tests | 746 € | abbex | mouse |
| abx572177 | Anti-Rat Ribonuclease T2 (RNASET2) ELISA Kit | inquire | 50 € | abbex | rat |
| GENTAUR-58bdc59821f99 | Anti- Ribonuclease T2 (RNASET2) Antibody | 100ug | 486 € | MBS Polyclonals | human |
| GENTAUR-58bdcb5dba1b5 | Anti- Ribonuclease T2 (RNASET2) Antibody | 50ug | 354 € | MBS Polyclonals | human |
| GENTAUR-58bdcb5e403a6 | Anti- Ribonuclease T2 (RNASET2) Antibody | 100ug | 453 € | MBS Polyclonals | human |
| GENTAUR-58bdda34e15ab | Anti- Ribonuclease T2 (RNASET2) Antibody | 100ug | 520 € | MBS Polyclonals | human |
| DL-RNASET2-Mu | Mouse Ribonuclease T2 RNASET2 ELISA Kit | 96T | 869 € | DL elisas | mouse |
| DL-RNASET2-Ra | Rat Ribonuclease T2 RNASET2 ELISA Kit | 96T | 904 € | DL elisas | rat |
| EKU07128 | Ribonuclease T2 (RNASET2) ELISA kit | 1 plate of 96 wells | 745 € | Biomatik ELISA kits | human |
| EKU07129 | Ribonuclease T2 (RNASET2) ELISA kit | 1 plate of 96 wells | 764 € | Biomatik ELISA kits | human |
| EKU07130 | Ribonuclease T2 (RNASET2) ELISA kit | 1 plate of 96 wells | 804 € | Biomatik ELISA kits | human |
| RP-1324H | Recombinant Human RNASET2 Protein (His Tag) | 10μg | 624 € | adv | human |
| MBS248602 | Anti-Human RNASET2 | 50ug | 597 € | MBS Polyclonals_1 | human |
| LV288855 | RNASET2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| GENTAUR-58bdf55cd078a | Anti- RNASET2 Antibody | 0.06 ml | 265 € | MBS Polyclonals | human |
| GENTAUR-58bdf55d5de55 | Anti- RNASET2 Antibody | 0.12 ml | 348 € | MBS Polyclonals | human |
| GENTAUR-58be115036a24 | Anti- RNASET2 Antibody | 0.12 ml | 348 € | MBS Polyclonals | human |
| GENTAUR-58be11508b4f4 | Anti- RNASET2 Antibody | 0.06 ml | 265 € | MBS Polyclonals | human |
| GENTAUR-58be4cceb443b | Anti- RNASET2 Antibody | 100ug | 387 € | MBS Polyclonals | human |
| GENTAUR-58be4ccf17f41 | Anti- RNASET2 Antibody | 0.2 mg | 558 € | MBS Polyclonals | human |
| AP55670CP-N | anti-RNASET2 (C-term) Control Peptide Antibody | 50 Вµg | 282 € | acr | human |
| AP53699PU-N | anti-RNASET2 (N-term) Antibody | 0,4 ml | 587 € | acr | human |
| abx931646 | Anti-RNASET2 siRNA | inquire | 50 € | abbex | human |