Recombinant Human PRADC1, PAP21 (C-6His)

Contact us
Catalog number: CI20
Price: 100 €
Supplier: novo
Product name: Recombinant Human PRADC1, PAP21 (C-6His)
Quantity: 10 µg
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human PRADC1 is produced by our Mammalian expression system and the target gene encoding His22-Trp188 is expressed with a 6His tag at the C-terminus
Molecular Weight: 20 kD
UniProt number: Q9BSG0
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFWVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PAP21 (C-6His), PRADC1
Short name: PAP21 (C-6His), Recombinant PRADC1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PAP21 (C-6His), sapiens PRADC1, recombinant H
Alternative technique: rec
Identity: 16047
Gene: PRADC1 | More about : PRADC1
Long gene name: protease associated domain containing 1
Synonyms gene: C2orf7
Synonyms gene name: chromosome 2 open reading frame 7
Synonyms: MGC13004 PAP21 hPAP21
Synonyms name: protease-associated domain-containing glycoprotein 21 kDa
Locus: 2p13, 2
Discovery year: 2001-07-27
GenBank acession: BC005069
Entrez gene record: 84279
Pubmed identfication: 15498570
RefSeq identity: NM_032319
Havana BLAST/BLAT: OTTHUMG00000129773

Related Products :

CI20 Recombinant Human PRADC1, PAP21 (C-6His) 10 µg 202 € novo human
abx929615 Anti-PRADC1 siRNA inquire 50 € abbex human
abx929616 Anti-PRADC1 siRNA inquire 50 € abbex human
GENTAUR-58bd9b6e52208 Mouse Protease-associated domain-containing protein 1 (Pradc1) 100ug 1542 € MBS Recombinant Proteins mouse
GENTAUR-58bd9b6eb0d85 Mouse Protease-associated domain-containing protein 1 (Pradc1) 1000ug 1542 € MBS Recombinant Proteins mouse
GENTAUR-58bd9b6f32088 Mouse Protease-associated domain-containing protein 1 (Pradc1) 100ug 2045 € MBS Recombinant Proteins mouse
GENTAUR-58bd9b6fa1bc2 Mouse Protease-associated domain-containing protein 1 (Pradc1) 1000ug 2045 € MBS Recombinant Proteins mouse
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
CC79 Recombinant Human GM-CSF, CSF2 (C-6His, Human Cells) 10 µg 146 € novo human
CD98 Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, Human Cells) 500 µg 1613 € novo human
CB01 Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells) 500 µg 1613 € novo human
C848 Recombinant Human 15-PGDH, HPGD (C-6His) 500 µg 1613 € novo human
CI63 Recombinant Human 17β-Hydroxysteroid Dehydrogenase 10, HSD17B10 (C-6His) 1 mg 2486 € novo human
CH76 Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein, OASLOASL (C-6His) 10 µg 202 € novo human
CE05 Recombinant Human 3-Hydroxybutyrate Dehydrogenase Type 2, BDH2, DHRS6 (N-6His) 50 µg 496 € novo human
CH04 Recombinant Human 4-1BB Ligand, 4-1BBL, TNFSF9, CD137L (C-6His) 500 µg 1613 € novo human
CP05 Recombinant Human 4-1BB, TNFRSF9, CD137 (C-6His) 1 mg 1014 € novo human
CJ38 Recombinant Human 4-1BB, TNFRSF9, CD137 (C-Fc-6His) 500 µg 709 € novo human
CE50 Recombinant Human 4-Hydroxyphenylpyruvate Dioxygenase, 4HPPD, HPPDase (N-6His) 10 µg 202 € novo human
CH74 Recombinant Human 40S Ribosomal Protein S7, RPS7 (C-6His) 500 µg 1613 € novo human
C591 Recombinant Human 5-Demethoxyubiquinone Hydroxylase, Mitochondrial, COQ7 (C-6His) 1 mg 2283 € novo human
CH64 Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase, MTHFS (C-6His) 1 mg 2486 € novo human
C446 Recombinant Human 5'-Nucleotidase, 5'-NT, CD73 (C-6His) 10 µg 202 € novo human
CG86 Recombinant Human 6-O-Methylguanine-DNA Methyltransferase, MGMT (N-6His) 10 µg 146 € novo human
CI74 Recombinant Human 6-Phosphogluconate Dehydrogenase, Decarboxylating, PGD (C-6His) 500 µg 780 € novo human
CF46 Recombinant Human ACADM, MCAD (N-6His) 1 mg 2283 € novo human
C421 Recombinant Human Acrosomal Protein SP-10, ACRV1 (C-6His) 50 µg 369 € novo human
CF89 Recombinant Human Actin-Related Protein 8, ACTR8 (N-6His) 1 mg 2486 € novo human
CH61 Recombinant Human Activating Transcription Factor 1, ATF1 (C-6His) 1 mg 2486 € novo human
CA76 Recombinant Human Activin Receptor 1A, Activin RI, ALK-2, ACVR1 (C-6His) 10 µg 100 € novo human