| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human PTPRN is produced by our E, Trp795-Leu888 is expressed with a 6His tag at the N-terminus, coli expression system and the target gene encoding Gln607-Asn686& |
| Molecular Weight: |
22, 9 kD |
| UniProt number: |
Q16849 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANGGGGSGGGGSGGGGSWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLL |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
N-6His), PTPRN (Gln607-Asn686 Trp795-Leu888, IA2 |
| Short name: |
N-6His), PTPRN (Gln607-Asn686 Trp795-Leu888, Recombinant IA2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
N (Gln607-Asn686 &, N-6His), Trp795-Leu888, protein tyrosine phosphatase, receptor classification, sapiens IA2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
GTPase binding, IA-2 and IA-2/PTP and IA2 and ICA512 and R-PTP-N, N, PTPRN and IDBG-643992 and ENSBTAG00000013798 and 286810, PTPRN and IDBG-81527 and ENSG00000054356 and 5798, Plasma membranes, Ptprn and IDBG-170581 and ENSMUSG00000026204 and 19275, receptor type, this GO :0000302 and response to reactive oxygen species and biological process this GO :0004725 and protein tyrosine phosphatase activity and molecular function this GO :0005001 and transmembrane receptor protein tyrosine phosphatase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006470 and protein dephosphorylation and biological process this GO :0009749 and response to glucose and biological process this GO :0016020 and membrane and cellular component this GO :0016311 and dephosphorylation and biological process this GO :0016791 and phosphatase activity and molecular function this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030507 and spectrin binding and molecular function this GO :0032868 and response to insulin and biological process this GO :0035335 and peptidyl-tyrosine dephosphorylation and biological process this GO :0043627 and response to estrogen and biological process this GO :0051020 and GTPase binding and molecular function this GO :0051591 and response to cAMP and biological process, this GO :0004725 : protein tyrosine phosphatase activity, this GO :0004725 : protein tyrosine phosphatase activity and also this GO :0005001 : transmembrane receptor protein tyrosine phosphatase activity and also this GO :0005515 : protein binding and also this GO :0016791 : phosphatase activity and also this GO :0030507 : spectrin binding and also this GO :0051020 : GTPase binding, this GO :0005001 : transmembrane receptor protein tyrosine phosphatase activity, this GO :0005515 : protein binding, this GO :0016791 : phosphatase activity, this GO :0030507 : spectrin binding, this GO :0051020 : GTPase binding, protein tyrosine phosphatase |
| Identity: |
9676 |
| Gene: |
PTPRN |
More about : PTPRN |
| Long gene name: |
protein tyrosine phosphatase, receptor type N |
| Synonyms: |
IA-2 |
| Locus: |
2q35 |
| Discovery year: |
1995-02-17 |
| Entrez gene record: |
5798 |
| Pubmed identfication: |
8024693 |
| Classification: |
Protein tyrosine phosphatases, receptor type |
| Havana BLAST/BLAT: |
OTTHUMG00000133129 |