| Catalog number: | CG99 |
|---|---|
| Price: | 348 € |
| Supplier: | MBS Polyclonals |
| Product name: | Recombinant Human Vitronectin, VTN-N (Val62-Leu478) |
| Quantity: | 0.12 ml |
| Other quantities: | 1 mg 253€ 50 µg 95€ 500 µg 192€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Vitronectin is produced by our E, coli expression system and the target gene encoding Val62-Leu478 is expressed |
| Molecular Weight: | 47, 6 kD |
| UniProt number: | P04004 |
| State of the product: | Liquid |
| Shipping conditions: | Dry Ice/ice packs |
| Formulation: | pH7, 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0 |
| Storage recommendations: | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | MVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | VTN-N (Val62-Leu478), Vitronectin |
| Short name: | VTN-N (Val62-Leu478), Recombinant Vitronectin |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | VTN-N (Val62-Leu478), sapiens Vitronectin, recombinant H |
| Alternative technique: | rec |
| CG99 | Recombinant Human Vitronectin, VTN-N (Val62-Leu478) | 10 µg | 75 € | novo | human |
| C395 | Recombinant Human Vitronectin, VTN (C-6His) | 1 mg | 659 € | novo | human |
| RP-1595M | Recombinant Mouse Vitronectin / VTN Protein (His Tag) | 50μg | 346 € | adv | mouse |
| abx575196 | Anti-Human Vitronectin (VTN) ELISA Kit | inquire | 50 € | abbex | human |
| AE57142HU-48 | ELISA test for Human Vitronectin (VTN) | 1x plate of 48 wells | 402 € | abebio | human |
| AE57142HU | Human Vitronectin (VTN) ELISA Kit | 96 wells plate | 810 € | ab-elisa elisas | human |
| AE57142HU-96 | Human Vitronectin (VTN) ELISA Kit | 1x plate of 96 wells | 671 € | abebio | human |
| DL-VTN-Hu | Human Vitronectin VTN ELISA Kit | 96T | 869 € | DL elisas | human |
| GENTAUR-58bde6f9000b5 | Mouse Monoclonal (IgG1,k) to Human VTN / Vitronectin Antibody | 0.05 ml | 597 € | MBS mono | human |
| abx574031 | Anti-Mouse Vitronectin (VTN) ELISA Kit | 96 tests | 775 € | abbex | mouse |
| abx576118 | Anti-Rat Vitronectin (VTN) ELISA Kit | 96 tests | 804 € | abbex | rat |
| GENTAUR-58bdc1fe68f05 | Anti- Vitronectin (VTN) Antibody | 50ug | 354 € | MBS Polyclonals | human |
| GENTAUR-58bdc1ff2fe46 | Anti- Vitronectin (VTN) Antibody | 100ug | 459 € | MBS Polyclonals | human |
| GENTAUR-58bdc6f874082 | Anti- Vitronectin (VTN) Antibody | 100ug | 470 € | MBS Polyclonals | human |
| GENTAUR-58bdc6f8d3ad0 | Anti- Vitronectin (VTN) Antibody | 50ug | 365 € | MBS Polyclonals | human |
| GENTAUR-58bdcc5a23b03 | Anti- Vitronectin (VTN) Antibody | 100ug | 509 € | MBS Polyclonals | human |
| GENTAUR-58bdce986ee14 | Anti- Vitronectin (VTN) Antibody | 50ug | 365 € | MBS Polyclonals | human |
| GENTAUR-58bdce98cabc3 | Anti- Vitronectin (VTN) Antibody | 100ug | 470 € | MBS Polyclonals | human |
| GENTAUR-58bdd1a1ba52a | Anti- Vitronectin (VTN) Antibody | 100ug | 509 € | MBS Polyclonals | human |
| GENTAUR-58bdd2815af10 | Anti- Vitronectin (VTN) Antibody | 100ug | 509 € | MBS Polyclonals | human |
| GENTAUR-58bdd8f110695 | Anti- Vitronectin (VTN) Antibody | 100ug | 542 € | MBS Polyclonals | human |
| GENTAUR-58bdd9be0ca36 | Anti- Vitronectin (VTN) Antibody | 100ug | 542 € | MBS Polyclonals | human |
| GENTAUR-58bddc9094c2a | Anti- Vitronectin (VTN) Antibody | 100ug | 542 € | MBS Polyclonals | human |
| DL-VTN-Mu | Mouse Vitronectin VTN ELISA Kit | 96T | 904 € | DL elisas | mouse |
| DL-VTN-Ra | Rat Vitronectin VTN ELISA Kit | 96T | 962 € | DL elisas | rat |
| EKU08172 | Vitronectin (VTN) ELISA kit | 1 plate of 96 wells | 783 € | Biomatik ELISA kits | human |
| EKU08173 | Vitronectin (VTN) ELISA kit | 1 plate of 96 wells | 804 € | Biomatik ELISA kits | human |
| EKU08174 | Vitronectin (VTN) ELISA kit | 1 plate of 96 wells | 846 € | Biomatik ELISA kits | human |
| LV356441 | VTN Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| GENTAUR-58bdf00ce4c3e | Anti- VTN Antibody | 0.12 ml | 348 € | MBS Polyclonals | human |