Recombinant Human Vitronectin, VTN-N (Val62-Leu478)

Contact us
Catalog number: CG99
Price: 348 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Vitronectin, VTN-N (Val62-Leu478)
Quantity: 0.12 ml
Other quantities: 10 µg 75€ 50 µg 95€ 500 µg 192€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Vitronectin is produced by our E, coli expression system and the target gene encoding Val62-Leu478 is expressed
Molecular Weight: 47, 6 kD
UniProt number: P04004
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: VTN-N (Val62-Leu478), Vitronectin
Short name: VTN-N (Val62-Leu478), Recombinant Vitronectin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: VTN-N (Val62-Leu478), sapiens Vitronectin, recombinant H
Alternative technique: rec

Related Products :

CG99 Recombinant Human Vitronectin, VTN-N (Val62-Leu478) 10 µg 75 € novo human
C395 Recombinant Human Vitronectin, VTN (C-6His) 1 mg 659 € novo human
RP-1595M Recombinant Mouse Vitronectin / VTN Protein (His Tag) 50μg 346 € adv mouse
abx575196 Anti-Human Vitronectin (VTN) ELISA Kit inquire 50 € abbex human
AE57142HU-48 ELISA test for Human Vitronectin (VTN) 1x plate of 48 wells 402 € abebio human
AE57142HU Human Vitronectin (VTN) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE57142HU-96 Human Vitronectin (VTN) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-VTN-Hu Human Vitronectin VTN ELISA Kit 96T 869 € DL elisas human
GENTAUR-58bde6f9000b5 Mouse Monoclonal (IgG1,k) to Human VTN / Vitronectin Antibody 0.05 ml 597 € MBS mono human
abx574031 Anti-Mouse Vitronectin (VTN) ELISA Kit 96 tests 775 € abbex mouse
abx576118 Anti-Rat Vitronectin (VTN) ELISA Kit 96 tests 804 € abbex rat
GENTAUR-58bdc1fe68f05 Anti- Vitronectin (VTN) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdc1ff2fe46 Anti- Vitronectin (VTN) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc6f874082 Anti- Vitronectin (VTN) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc6f8d3ad0 Anti- Vitronectin (VTN) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdcc5a23b03 Anti- Vitronectin (VTN) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdce986ee14 Anti- Vitronectin (VTN) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdce98cabc3 Anti- Vitronectin (VTN) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdd1a1ba52a Anti- Vitronectin (VTN) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd2815af10 Anti- Vitronectin (VTN) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd8f110695 Anti- Vitronectin (VTN) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd9be0ca36 Anti- Vitronectin (VTN) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bddc9094c2a Anti- Vitronectin (VTN) Antibody 100ug 542 € MBS Polyclonals human
DL-VTN-Mu Mouse Vitronectin VTN ELISA Kit 96T 904 € DL elisas mouse
DL-VTN-Ra Rat Vitronectin VTN ELISA Kit 96T 962 € DL elisas rat
EKU08172 Vitronectin (VTN) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU08173 Vitronectin (VTN) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
EKU08174 Vitronectin (VTN) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
LV356441 VTN Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdf00ce4c3e Anti- VTN Antibody 0.12 ml 348 € MBS Polyclonals human