Recombinant Human Vitronectin, VTN-N (Val62-Leu478)

Catalog number:	CG99 Buy Now
Price:	348 €
Supplier:	MBS Polyclonals
Product name:	Recombinant Human Vitronectin, VTN-N (Val62-Leu478)
Quantity:	0.12 ml
Other quantities:	1 mg 253€ 10 µg 75€ 50 µg 95€
Related search:	human recombinant sapiens vtnn alternative uniprot

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Vitronectin is produced by our E, coli expression system and the target gene encoding Val62-Leu478 is expressed
Molecular Weight:	47, 6 kD
UniProt number:	P04004
State of the product:	Liquid
Shipping conditions:	Dry Ice/ice packs
Formulation:	pH7, 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	VTN-N (Val62-Leu478), Vitronectin
Short name:	VTN-N (Val62-Leu478), Recombinant Vitronectin
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	VTN-N (Val62-Leu478), sapiens Vitronectin, recombinant H
Alternative technique:	rec

• #human
• #recombinant
• #sapiens
• #vtnn
• #alternative
• #uniprot