| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Reticulon-4 is produced by our E, coli expression system and the target gene encoding Met1-Val185 is expressed with a GST tag at the N-terminus |
| Molecular Weight: |
45, 5 kD |
| UniProt number: |
Q9NQC3-3 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of 20 mM PB，150 mM sodium chloride, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPPARPPPPPPASVSPQAEPVWTPPAPAPAAPPSTPAAPKRRGSSGSV |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
RTN4 (N-GST), Reticulon-4, Nogo-A |
| Short name: |
RTN4 (N-GST), Reticulon-4, Recombinant Nogo-A |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Reticulon-4, reticulon 4 (N-GST), sapiens Nogo-A, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
RTN4 and IDBG-52161 and ENSG00000115310 and 57142, RTN4 and IDBG-633945 and ENSBTAG00000011104 and 359718, Rtn4 and IDBG-157815 and ENSMUSG00000020458 and 68585, nuclei, poly(A) RNA binding, this GO :0001525 and angiogenesis and biological process this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005635 and nuclear envelope and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0007399 and nervous system development and biological process this GO :0007413 and axonal fasciculation and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0021801 and cerebral cortex radial glia guided migration and biological process this GO :0030176 and integral component of endoplasmic reticulum membrane and cellular component this GO :0030308 and negative regulation of cell growth and biological process this GO :0030334 and regulation of cell migration and biological process this GO :0030517 and negative regulation of axon extension and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0042995 and cell projection and cellular component this GO :0043025 and neuronal cell body and cellular component this GO :0044822 and poly(A) RNA binding and molecular function this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0050770 and regulation of axonogenesis and biological process this GO :0050771 and negative regulation of axonogenesis and biological process this GO :0051960 and regulation of nervous system development and biological process this GO :0060317 and cardiac epithelial to mesenchymal transition and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071786 and endoplasmic reticulum tubular network organization and biological process this GO :2000172 and regulation of branching morphogenesis of a nerve and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0044822 : poly(A) RNA binding, this GO :0044822 : poly(A) RNA binding, reticulon 4 |
| Identity: |
14085 |
| Gene: |
RTN4 |
More about : RTN4 |
| Long gene name: |
reticulon 4 |
| Synonyms: |
NSP-CL KIAA0886 NOGO ASY |
| Locus: |
2p16, 1 |
| Discovery year: |
2000-11-28 |
| GenBank acession: |
AF087901 |
| Entrez gene record: |
57142 |
| Pubmed identfication: |
10667797 10773680 |
| Havana BLAST/BLAT: |
OTTHUMG00000129337 |