| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Caspase-10 is produced by our E, coli expression system and the target gene encoding Val220-Ile480 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
1 kD, 30 |
| UniProt number: |
Q92851-2 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
10 mM DTT, pH 7, 2 um filtered solution of 25 mM HEPES, 5, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CASP10 (C-6His), Caspase-10 |
| Short name: |
CASP10 (C-6His), Recombinant Caspase-10 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
apoptosis-related cysteine peptidase (C-6His), caspase 10, sapiens caspase-10, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ALPS2 and FLICE2 and MCH4, CASP10 and IDBG-78470 and ENSG00000003400 and 843, Plasma membranes, apoptosis-related cysteine peptidase, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006508 and proteolysis and biological process this GO :0006915 and apoptotic process and biological process this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0031265 and CD95 death-inducing signaling complex and cellular component this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0035877 and death effector domain binding and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0045087 and innate immune response and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097199 and cysteine-type endopeptidase activity involved in apoptotic signaling pathway and molecular function this GO :0097342 and ripoptosome and cellular component, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0005515 : protein binding and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0031625 : ubiquitin protein ligase binding and also this GO :0035877 : death effector domain binding and also this GO :0097199 : cysteine-type endopeptidase activity involved in apoptotic signaling pathway, this GO :0005515 : protein binding, this GO :0008234 : cysteine-type peptidase activity, this GO :0031625 : ubiquitin protein ligase binding, this GO :0035877 : death effector domain binding, this GO :0097199 : cysteine-type endopeptidase activity involved in apoptotic signaling pathway, caspase 10 |
| Identity: |
1500 |
| Gene: |
CASP10 |
More about : CASP10 |
| Long gene name: |
caspase 10 |
| Synonyms gene name: |
apoptosis-related cysteine peptidase , apoptosis-related cysteine protease caspase 10, caspase 10 |
| Synonyms: |
MCH4 |
| Locus: |
2q33, 1 |
| Discovery year: |
1997-04-21 |
| GenBank acession: |
U60519 |
| Entrez gene record: |
843 |
| Pubmed identfication: |
8755496 |
| RefSeq identity: |
NM_032977 |
| Classification: |
Caspases Death effector domain containing Death inducing signaling complex |
| Havana BLAST/BLAT: |
OTTHUMG00000132818 |
| Locus Specific Databases: |
CASP10base: Mutation registry for Autoimmune lymphoproliferative syndrome, type II (ALPS2) LRG_33 |