Recombinant Human Caspase-10, CASP10 (C-6His)

Contact us
Catalog number: CF93
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human Caspase-10, CASP10 (C-6His)
Quantity: 0.1ml
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Caspase-10 is produced by our E, coli expression system and the target gene encoding Val220-Ile480 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 30
UniProt number: Q92851-2
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 10 mM DTT, pH 7, 2 um filtered solution of 25 mM HEPES, 5, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CASP10 (C-6His), Caspase-10
Short name: CASP10 (C-6His), Recombinant Caspase-10
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: apoptosis-related cysteine peptidase (C-6His), caspase 10, sapiens caspase-10, recombinant H
Alternative technique: rec
Alternative to gene target: ALPS2 and FLICE2 and MCH4, CASP10 and IDBG-78470 and ENSG00000003400 and 843, Plasma membranes, apoptosis-related cysteine peptidase, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006508 and proteolysis and biological process this GO :0006915 and apoptotic process and biological process this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0031265 and CD95 death-inducing signaling complex and cellular component this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0035877 and death effector domain binding and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0045087 and innate immune response and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097199 and cysteine-type endopeptidase activity involved in apoptotic signaling pathway and molecular function this GO :0097342 and ripoptosome and cellular component, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0005515 : protein binding and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0031625 : ubiquitin protein ligase binding and also this GO :0035877 : death effector domain binding and also this GO :0097199 : cysteine-type endopeptidase activity involved in apoptotic signaling pathway, this GO :0005515 : protein binding, this GO :0008234 : cysteine-type peptidase activity, this GO :0031625 : ubiquitin protein ligase binding, this GO :0035877 : death effector domain binding, this GO :0097199 : cysteine-type endopeptidase activity involved in apoptotic signaling pathway, caspase 10
Identity: 1500
Gene: CASP10 | More about : CASP10
Long gene name: caspase 10
Synonyms gene name: apoptosis-related cysteine peptidase , apoptosis-related cysteine protease caspase 10, caspase 10
Synonyms: MCH4
Locus: 2q33, 1
Discovery year: 1997-04-21
GenBank acession: U60519
Entrez gene record: 843
Pubmed identfication: 8755496
RefSeq identity: NM_032977
Classification: Caspases Death effector domain containing Death inducing signaling complex
Havana BLAST/BLAT: OTTHUMG00000132818
Locus Specific Databases: CASP10base: Mutation registry for Autoimmune lymphoproliferative syndrome, type II (ALPS2) LRG_33

Related Products :

CF93 Recombinant Human Caspase-10, CASP10 (C-6His) 50 µg 496 € novo human
MBS247113 PAb (IgG) to Human CASP10 / Caspase 10 50ug 597 € MBS Polyclonals_1 human
LV107698 CASP10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV107699 CASP10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV107700 CASP10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV107701 CASP10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV107703 CASP10 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV107702 CASP10 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdf3f90d836 Anti- CASP10 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf3f9779a0 Anti- CASP10 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0acbeea8d Anti- CASP10 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0acc666bd Anti- CASP10 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be13641cfa5 Anti- CASP10 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be13648ce94 Anti- CASP10 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be4222f381f Anti- CASP10 Antibody 100ug 393 € MBS Polyclonals human
abx148924 Anti-CASP10 Antibody 200 μg 369 € abbex human
abx910328 Anti-CASP10 siRNA inquire 50 € abbex human
GWB-MV463D CASP10 antibody 1 vial 521 € genways human
CG19 Recombinant Human Caspase-14, CASP14 (C-6His) 1 mg 2486 € novo human
GENTAUR-58be6502d2539 Anti-Caspase 4+Caspase 11 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
MBS624537 CASP9, ID (Caspase 9, Caspase-9, CASP-9, ICE-like Apoptotic Protease 6, ICE-LAP6, Apoptotic Protease Mch-6, Apoptotic Protease-activating Factor 3, APAF-3, MCH6) Antibody 200ul 597 € MBS Polyclonals_1 human
bs-6858R-A350 Caspase 4+Caspase 11 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6858R-A488 Caspase 4+Caspase 11 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6858R-A555 Caspase 4+Caspase 11 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6858R-A594 Caspase 4+Caspase 11 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6858R-A647 Caspase 4+Caspase 11 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6858R-Biotin Caspase 4+Caspase 11 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-6858R Caspase 4+Caspase 11 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-6858R-Cy3 Caspase 4+Caspase 11 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-6858R-Cy5 Caspase 4+Caspase 11 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human