Recombinant Human Estrogen Receptor β, ERβ, NR3A2 (N-6His)

Contact us
Catalog number: CF53
Price: 369 €
Supplier: novo
Product name: Recombinant Human Estrogen Receptor β, ERβ, NR3A2 (N-6His)
Quantity: 50 µg
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Estrogen Receptor Beta is produced by our E, coli expression system and the target gene encoding Met1-Ala323 is expressed with a 6His tag at the N-terminus
Molecular Weight: 1 kD, 38
UniProt number: Q92731-3
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 50 mM TrisHCl,pH8, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ER&beta, NR3A2 (N-6His), Estrogen Receptor &beta
Short name: ER&beta, NR3A2 (N-6His), Recombinant Estrogen Receptor &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: ER&beta, NR3A2 (N-6His), sapiens Estrogen Receptor &beta, recombinant H
Alternative technique: rec
Identity: 3468
Gene: ESR2 | More about : ESR2
Long gene name: estrogen receptor 2
Synonyms gene name: estrogen receptor 2 (ER beta)
Synonyms: NR3A2 Erb
Synonyms name: ER beta
Locus: 14q23, 2-q23, 3
Discovery year: 1997-01-17
GenBank acession: X99101
Entrez gene record: 2100
Pubmed identfication: 8769313
Classification: Nuclear hormone receptors
Havana BLAST/BLAT: OTTHUMG00000141306

Related Products :

CF53 Recombinant Human Estrogen Receptor β, ERβ, NR3A2 (N-6His) 50 µg 369 € novo human
GWB-EC0DFD Estrogen Receptor B (ER B/NR3A2) (ESR2) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 vial 648 € genways human
MBS624144 Estrogen Receptor alpha, phosphorylated (Ser104) (ER, ER alpha, Era, ESR, ESR, ESR1, ESRA, Estradiol Receptor, Estrogen Receptor, Estrogen Receptor 1) Antibody 50ug 481 € MBS Polyclonals_1 human
MBS480074 Anti-ERbeta (Human), polyclonal 100ug 415 € MBS Polyclonals_1 human
MBS619674 Estrogen-Related Receptor, gamma (ERR gamma, ERRg, ESRRG, DKFZP781L1617, Estrogen Receptor Related Protein 3, ERR3, FLJ16023, KIAA0832, Nuclear Receptor Subfamily 3 Group B Member 3, NR3B3) Antibody 50ug 928 € MBS Polyclonals_1 human
MBS617658 Nuclear Receptor LXR beta (NR1H2, Liver X Receptor beta, LX Receptor beta, LXRB, LXR-b, LXR beta, NER1, NERI, Nuclear Orphan Receptor LXR beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Oxysterols Receptor LXR beta, RIP15, Stero Antibody 100ug 735 € MBS Polyclonals_1 human
CE11 Recombinant Human Estrogen Receptor α, ERα, NR3A1 (N-6His) 500 µg 1613 € novo human
MBS619896 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX Receptor beta, LXRa, LXR-a, LXRalpha, LXRb, LXR-b, LXRbeta, NERI, NER-I, NR1H2, NR1H3, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 100ug 763 € MBS Polyclonals_1 human
MBS611189 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX receptor beta, LXRa, LXRalpha, LXRb, LXRbeta, NERI, NR1H2, NR1H3, Nuclear Orphan Receptor LXR alpha, Nuclear Orphan Receptor LXR beta, Nuclear Receptor Antibody 100ug 735 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
C380 Recombinant Human Platelet-Derived Growth Factor Receptor β, PDGFR-β (C-6His) 1 mg 1674 € novo human
MBS622393 Adrenergic Receptor, beta 2 (ADRB2, Adrenergic, Beta-2-, Receptor, Surface [Homo sapiens], HGNC:286, ADRB2R, ADRBR, B2AR, BAR, BETA2AR, beta-2 Adrenergic Receptor, beta-2 Adrenoceptor, Catecholamine Receptor) 100ug 707 € MBS Polyclonals_1 human
MBS624548 Estrogen Receptor, phosphorylated (S118) (ER, ER-alpha, Estradiol Receptor, Nuclear Receptor Subfamily 3 Group A Member 1, ESR1, ESR, NR3A1) Antibody 100ug 680 € MBS Polyclonals_1 human
MBS622505 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Ox-1-R, Ox1-R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) Antibody 100ug 652 € MBS Polyclonals_1 human
C632 Recombinant Human Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-6His) 1 mg 2283 € novo human
CC08 Recombinant Human IL-10 Receptor Subunit β, IL-10RB (C-6His) 50 µg 202 € novo human
CJ81 Recombinant Human IL-2 Receptor Subunit β, IL-2RB, CD122 (C-6His) 50 µg 496 € novo human
C358 Recombinant Human Interferon α, β Receptor 1, IFNAR1 (C-6His) 500 µg 1613 € novo human
C476 Recombinant Human Interferon α, β Receptor 2, IFNAR2 (C-6His) 50 µg 273 € novo human
CI32 Recombinant Human Neuronal Acetylcholine Receptor Subunit β-3, CHRNB3 (C-6His) 10 µg 156 € novo human
C496 Recombinant Human Oncostatin-M-Specific Receptor Subunit β, OSMRB, IL-31RB (C-6His) 10 µg 131 € novo human
CM42 Recombinant Mouse Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-6His) 10 µg 126 € novo mouse
C247 Recombinant Human cAMP-dependent Protein Kinase Inhibitor β, PKI-β (N-6His) 50 µg 496 € novo human
CH77 Recombinant Human Glia Maturation Factor β, GMF-β, GMFB (C-6His) 10 µg 100 € novo human
CM05 Recombinant Mouse Transforming Growth Factor-β Receptor Type II, TGFBR2 (C-6His) 50 µg 232 € novo human
RP-940 Recombinant (E.Coli) Human Estrogen Receptor Alpha 2 μg 405 € adi human
YSGSRA1000D Estrogen Receptor (ER), Hinge Region, Native Receptor in activated 4S state, ~67kD, Clone: h-151, Mouse Monoclonal antibody-Human, Mouse, Rat, Bovine; WB/IP/IHC/GS 50 ug 618 € accurate-monoclonals bovine
YSGSRA1010D Estrogen Receptor (ER), Inactive 8S Oligomeric state, Native Receptor in activated 4S state, ~67kD, Clone: C-542, Mouse Monoclonal antibody-Human, Mouse, Rat, Hamster; WB/IP/ICC/IHC/GS 50 ug 618 € accurate-monoclonals hamster
CG97 Recombinant Cavia porcellus Interleukin-1 Beta, IL-1 beta (C-6His) 1 mg 2283 € novo human
CH85 Recombinant E. coli β-Glucuronidase, β-GUS, GUSB (N-6His) 50 µg 369 € novo human