| Reacts with: |
E, coli |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant E, coli beta-Glucuronidase is produced by our E, coli expression system and the target gene encoding Met1-Gln603 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
69, 9 kD |
| UniProt number: |
P05804 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MNHKVHHHHHHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Group: |
recombinants |
| Gene target: |
&beta, GUSB (N-6His), &beta, -GUS, -Glucuronidase |
| Short name: |
&beta, GUSB (N-6His), coli &beta, -GUS, -Glucuronidase, Recombinant E |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host: |
Escherichia coli |
| Species: |
coli, E |
| Alternative name: |
&beta, GUSB (N-6His), coli &beta, -GUS, -Glucuronidase, recombinant E |
| Alternative technique: |
rec |
| Identity: |
4696 |
| Gene: |
GUSB |
More about : GUSB |
| Long gene name: |
glucuronidase beta |
| Synonyms gene name: |
beta , glucuronidase |
| Locus: |
7q11, 21 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M15182 |
| Entrez gene record: |
2990 |
| Pubmed identfication: |
3468507 |
| RefSeq identity: |
NM_000181 |
| Havana BLAST/BLAT: |
OTTHUMG00000023735 |