Recombinant Human C-X-C Motif Chemokine 5, CXCL5

Contact us
Catalog number: CF14
Price: 2283 €
Supplier: novo
Product name: Recombinant Human C-X-C Motif Chemokine 5, CXCL5
Quantity: 1 mg
Other quantities: 1 mg 2283€ 50 µg 339€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 7, 95 kD
UniProt number: P42830
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 6, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CXCL5, C-X-C Motif Chemokine 5
Short name: CXCL5, Recombinant C-X-C Motif Chemokine 5
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: chemokine (C-X-C motif) ligand 5, sapiens C-X-C Motif Chemokine 5, recombinant H
Alternative technique: rec
Alternative to gene target: CXCL5 and IDBG-24181 and ENSG00000163735 and 6374, ENA-78 and SCYB5, Extracellular, chemokine activity, this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity, chemokine (C-X-C motif) ligand 5
Identity: 10642
Gene: CXCL5 | More about : CXCL5
Long gene name: C-X-C motif chemokine ligand 5
Synonyms gene: SCYB5
Synonyms gene name: member 5 (epithelial-derived neutrophil-activating peptide 78) chemokine (C-X-C motif) ligand 5 , small inducible cytokine subfamily B (Cys-X-Cys)
Synonyms: ENA-78
Locus: 4q13, 3
Discovery year: 1996-09-03
GenBank acession: X78686
Entrez gene record: 6374
Pubmed identfication: 7929219
RefSeq identity: NM_002994
Classification: Endogenous ligands Chemokine ligands
Havana BLAST/BLAT: OTTHUMG00000160871

Related Products :

MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
CF14 Recombinant Human C-X-C Motif Chemokine 5, CXCL5 1 mg 2283 € novo human
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS621206 CXCL5 (Chemokine (C-X-C Motif) Ligand 5, Epithelial Derived Neutrophil Activating Peptide 78, Epithelial Derived Neutrophil Activating Protein 78, ENA78, ENA-78, Neutrophil Activating Peptide ENA-78, Small Inducible Cytokine Subfamily B Member 5, Small In Antibody 50ug 774 € MBS Polyclonals_1 human
GENTAUR-58be31bbb4dcf CCR8, loop2 (chemokine receptor 8, C-C chemokine receptor type 8, CC-CKR-8, C-C CKR-8, CCR-8, CDw198, Chemokine receptor-like 1, CKRL1) Antibody 100ul 707 € MBS mono human
MBS611205 LEC, NCC-4 (Liver-Expressed Chemokine, New Chemokine CC-4, Small Inducible Cytokine Subfamily A (Cys X Cys) member 16, SCYA16, IL-10-inducible Chemokine, Monotactin-1) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS619083 BCA-1 (B Cell Attracting Chemokine 1, BCA1, B Lymphocyte Chemoattractant, ANGIE, ANGIE2, BLC, BLR1 Ligand, BLR1L, Chemokine (C-X-C Motif) Ligand 13 (B-cell Chemoattractant), C-X-C Motif Chemokine 13, CXCL13, CXC Chemokine BLC, Small Inducible Cytokine B S Antibody 50ug 774 € MBS Polyclonals_1 human
MBS623554 CCR7 (C-C Chemokine Receptor Type 7, Chemokine (C-C Motif) Receptor 7, C-C CKR-7, CC-CKR-7, CCR-7, BLR2, CD197, CDw197, CMKBR7, Epstein-Barr Virus-induced G-protein Coupled Receptor 1, EBV Induced G Protein Coupled Receptor 1, EBI1, EVI1, MIP-3 beta Recep Antibody 100ug 619 € MBS Polyclonals_1 virus
MBS622999 TRIM3 (Tripartite Motif Containing 3, Tripartite Motif-containing 3, Tripartite Motif Protein TRIM3, Brain Expressed Ring Finger, Brain-expressed Ring Finger, BERP, HAC1, Ring Finger Protein 22, RNF22, Ring Finger Protein 97, RNF97) 100ug 785 € MBS Polyclonals_1 human
MBS621891 TRIM56 (Tripartite Motif Containing 56, Tripartite Motif-containing 56, Tripartite Motif Containing Protein 56, DKFZp667O116, A130009K11Rik, FLJ35608, Gm452, MGC37358, OTTMUSP00000027392, RING Finger Protein 109, RNF109) 100ul 785 € MBS Polyclonals_1 human
MBS612668 Lipopolysaccharide-induced CXC Chemokine (LIX, CXCL5) Antibody 100ug 763 € MBS Polyclonals_1 human
MBS616514 Lipopolysaccharide-induced CXC Chemokine (LIX, CXCL5) Antibody 100ug 785 € MBS Polyclonals_1 human
C094 Recombinant Human C-C Motif Chemokine 1, CCL1 500 µg 1613 € novo human
CF47 Recombinant Human C-C Motif Chemokine 11, CCL11, Eotaxin 50 µg 339 € novo human
C439 Recombinant Human C-C Motif Chemokine 14, CCL14, HCC-3 (C-6His) 10 µg 156 € novo human
C064 Recombinant Human C-C Motif Chemokine 16, CCL16 50 µg 405 € novo human
C599 Recombinant Human C-C motif chemokine 17, CCL17 (C-6His) 10 µg 126 € novo human
CF38 Recombinant Human C-C Motif Chemokine 18, CCL18, PARC (N-6His) 10 µg 202 € novo human
CM78 Recombinant Human C-C Motif Chemokine 2, CCL2, MCP-1 500 µg 1755 € novo human
C090 Recombinant Human C-C Motif Chemokine 23, CCL23 10 µg 168 € novo human
CC43 Recombinant Human C-C Motif Chemokine 24, CCL24, Eotaxin-2, MPIF-2 (C-6His) 1 mg 2283 € novo human