| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
7, 95 kD |
| UniProt number: |
P42830 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 6, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CXCL5, C-X-C Motif Chemokine 5 |
| Short name: |
CXCL5, Recombinant C-X-C Motif Chemokine 5 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
chemokine (C-X-C motif) ligand 5, sapiens C-X-C Motif Chemokine 5, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CXCL5 and IDBG-24181 and ENSG00000163735 and 6374, ENA-78 and SCYB5, Extracellular, chemokine activity, this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity, chemokine (C-X-C motif) ligand 5 |
| Identity: |
10642 |
| Gene: |
CXCL5 |
More about : CXCL5 |
| Long gene name: |
C-X-C motif chemokine ligand 5 |
| Synonyms gene: |
SCYB5 |
| Synonyms gene name: |
member 5 (epithelial-derived neutrophil-activating peptide 78) chemokine (C-X-C motif) ligand 5 , small inducible cytokine subfamily B (Cys-X-Cys) |
| Synonyms: |
ENA-78 |
| Locus: |
4q13, 3 |
| Discovery year: |
1996-09-03 |
| GenBank acession: |
X78686 |
| Entrez gene record: |
6374 |
| Pubmed identfication: |
7929219 |
| RefSeq identity: |
NM_002994 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000160871 |