| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human High Mobility Group Protein B1 is produced by our E, coli expression system and the target gene encoding Gly2-Phe89 is expressed |
| Molecular Weight: |
10, 5 kD |
| UniProt number: |
P09429 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of 50 mMHepes, 5 mMDTT, 500 mMsodium chloride, 9 , Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKF |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
HMGB1, Mobility Group Protein B1 |
| Short name: |
HMGB1, Recombinant High Mobility Group Protein B1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
high mobility family box 1, sapiens High Mobility family Protein B1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
DNA binding, DNA ligation and biological process this GO :0006309 and apoptotic DNA fragmentation and biological process this GO :0006310 and DNA recombination and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006915 and apoptotic process and biological process this GO :0006921 and cellular component disassembly involved in execution phase of apoptosis and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0008301 and DNA binding, HMG1 and HMG3 and SBP-1, HMGB1 and IDBG-21100 and ENSG00000189403 and 3146, HMGB1 and IDBG-630533 and ENSBTAG00000018103 and 282691, Hmgb1 and IDBG-209311 and ENSMUSG00000066551 and 100862258, bending, bending and also this GO :0042056 : chemoattractant activity and also this GO :0044822 : poly(A) RNA binding and also this GO :0050786 : RAGE receptor binding and also this GO :0070491 : repressing transcription factor binding, bending and molecular function this GO :0009986 and cell surface and cellular component this GO :0017053 and transcriptional repressor complex and cellular component this GO :0017055 and negative regulation of RNA polymerase II transcriptional preinitiation complex assembly and biological process this GO :0031175 and neuron projection development and biological process this GO :0033151 and V(D)J recombination and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043388 and positive regulation of DNA binding and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0050918 and positive chemotaxis and biological process this GO :0051103 and DNA ligation involved in DNA repair and biological process this GO :0070491 and repressing transcription factor binding and molecular function this GO :2000426 and negative regulation of apoptotic cell clearance and biological process, nuclei, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000793 and condensed chromosome and cellular component this GO :0001773 and myeloid dendritic cell activation and biological process this GO :0002407 and dendritic cell chemotaxis and biological process this GO :0002437 and inflammatory response to antigenic stimulus and biological process this GO :0003677 and DNA binding and molecular function this GO :0003684 and damaged DNA binding and molecular function this GO :0003690 and double-stranded DNA binding and molecular function this GO :0003697 and single-stranded DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0006265 and DNA topological change and biological process this GO :0006288 and base-excision repair, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003684 : damaged DNA binding and also this GO :0003690 : double-stranded DNA binding and also this GO :0003697 : single-stranded DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding and also this GO :0008134 : transcription factor binding and also this GO :0008301 : DNA binding, this GO :0003684 : damaged DNA binding, this GO :0003690 : double-stranded DNA binding, this GO :0003697 : single-stranded DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005125 : cytokine activity, this GO :0005515 : protein binding, this GO :0008134 : transcription factor binding, this GO :0008301 : DNA binding, this GO :0042056 : chemoattractant activity, this GO :0044822 : poly(A) RNA binding, this GO :0050786 : RAGE receptor binding, this GO :0070491 : repressing transcription factor binding, 15289, 619937, 102642363, high mobility group box 1 |
| Identity: |
4983 |
| Gene: |
HMGB1 |
More about : HMGB1 |
| Long gene name: |
high mobility group box 1 |
| Synonyms gene: |
HMG1 |
| Synonyms gene name: |
high-mobility group (nonhistone chromosomal) protein 1 high-mobility group box 1 |
| Synonyms: |
HMG3 SBP-1 DKFZp686A04236 |
| Synonyms name: |
high mobility group box 1 Sulfoglucuronyl carbohydrate binding protein Amphoterin high mobility group protein 1 |
| Locus: |
13q12, 3 |
| Discovery year: |
1993-12-13 |
| GenBank acession: |
D63874 |
| Entrez gene record: |
3146 |
| Pubmed identfication: |
8661151 11279268 |
| RefSeq identity: |
NM_002128 |
| Classification: |
Canonical high mobility group |
| Havana BLAST/BLAT: |
OTTHUMG00000016670 |