Recombinant Human High Mobility Group Protein B1, HMGB1

Contact us
Catalog number: CE66
Price: 2166 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human High Mobility Group Protein B1, HMGB1
Quantity: 1000ug
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human High Mobility Group Protein B1 is produced by our E, coli expression system and the target gene encoding Gly2-Phe89 is expressed
Molecular Weight: 10, 5 kD
UniProt number: P09429
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of 50 mMHepes, 5 mMDTT, 500 mMsodium chloride, 9 , Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKF
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HMGB1, Mobility Group Protein B1
Short name: HMGB1, Recombinant High Mobility Group Protein B1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: high mobility family box 1, sapiens High Mobility family Protein B1, recombinant H
Alternative technique: rec
Alternative to gene target: DNA binding, DNA ligation and biological process this GO :0006309 and apoptotic DNA fragmentation and biological process this GO :0006310 and DNA recombination and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006915 and apoptotic process and biological process this GO :0006921 and cellular component disassembly involved in execution phase of apoptosis and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0008301 and DNA binding, HMG1 and HMG3 and SBP-1, HMGB1 and IDBG-21100 and ENSG00000189403 and 3146, HMGB1 and IDBG-630533 and ENSBTAG00000018103 and 282691, Hmgb1 and IDBG-209311 and ENSMUSG00000066551 and 100862258, bending, bending and also this GO :0042056 : chemoattractant activity and also this GO :0044822 : poly(A) RNA binding and also this GO :0050786 : RAGE receptor binding and also this GO :0070491 : repressing transcription factor binding, bending and molecular function this GO :0009986 and cell surface and cellular component this GO :0017053 and transcriptional repressor complex and cellular component this GO :0017055 and negative regulation of RNA polymerase II transcriptional preinitiation complex assembly and biological process this GO :0031175 and neuron projection development and biological process this GO :0033151 and V(D)J recombination and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043388 and positive regulation of DNA binding and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0050918 and positive chemotaxis and biological process this GO :0051103 and DNA ligation involved in DNA repair and biological process this GO :0070491 and repressing transcription factor binding and molecular function this GO :2000426 and negative regulation of apoptotic cell clearance and biological process, nuclei, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000793 and condensed chromosome and cellular component this GO :0001773 and myeloid dendritic cell activation and biological process this GO :0002407 and dendritic cell chemotaxis and biological process this GO :0002437 and inflammatory response to antigenic stimulus and biological process this GO :0003677 and DNA binding and molecular function this GO :0003684 and damaged DNA binding and molecular function this GO :0003690 and double-stranded DNA binding and molecular function this GO :0003697 and single-stranded DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0006265 and DNA topological change and biological process this GO :0006288 and base-excision repair, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003684 : damaged DNA binding and also this GO :0003690 : double-stranded DNA binding and also this GO :0003697 : single-stranded DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding and also this GO :0008134 : transcription factor binding and also this GO :0008301 : DNA binding, this GO :0003684 : damaged DNA binding, this GO :0003690 : double-stranded DNA binding, this GO :0003697 : single-stranded DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005125 : cytokine activity, this GO :0005515 : protein binding, this GO :0008134 : transcription factor binding, this GO :0008301 : DNA binding, this GO :0042056 : chemoattractant activity, this GO :0044822 : poly(A) RNA binding, this GO :0050786 : RAGE receptor binding, this GO :0070491 : repressing transcription factor binding, 15289, 619937, 102642363, high mobility group box 1
Identity: 4983
Gene: HMGB1 | More about : HMGB1
Long gene name: high mobility group box 1
Synonyms gene: HMG1
Synonyms gene name: high-mobility group (nonhistone chromosomal) protein 1 high-mobility group box 1
Synonyms: HMG3 SBP-1 DKFZp686A04236
Synonyms name: high mobility group box 1 Sulfoglucuronyl carbohydrate binding protein Amphoterin high mobility group protein 1
Locus: 13q12, 3
Discovery year: 1993-12-13
GenBank acession: D63874
Entrez gene record: 3146
Pubmed identfication: 8661151 11279268
RefSeq identity: NM_002128
Classification: Canonical high mobility group
Havana BLAST/BLAT: OTTHUMG00000016670

Related Products :

MBS610453 HMG4 (High Mobility Group 4 (HMG) Transcription Factor, High Mobility Group Protein 2a, HMG2a, High Mobility Group Box 3, HMGB3, MGC90319, Nonhistone Chromosomal Protein HMG4) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS612981 HMG17, HMGN2 (High Mobility Group (HMG) Transcription Factor, High Mobility Group Nucleosomal Binding Domain 2) Antibody 50ug 382 € MBS Polyclonals_1 human
CE66 Recombinant Human High Mobility Group Protein B1, HMGB1 1 mg 2283 € novo human
C357 Recombinant Human High Mobility Group Protein B1, HMGB1 (C-6His) 500 µg 1613 € novo human
CH67 Recombinant Human High Mobility Group Protein B1, HMGB1 (N-MARI) 10 µg 156 € novo human
GENTAUR-58bd0943264ef Arabidopsis thaliana High mobility group B protein 1 (HMGB1) 100ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bd0943779cd Arabidopsis thaliana High mobility group B protein 1 (HMGB1) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bd0943d1cbb Arabidopsis thaliana High mobility group B protein 1 (HMGB1) 100ug 2072 € MBS Recombinant Proteins human
GENTAUR-58bd09441d4c5 Arabidopsis thaliana High mobility group B protein 1 (HMGB1) 1000ug 2072 € MBS Recombinant Proteins human
GENTAUR-58b8a98c45393 Callicebus moloch High mobility group protein B1 (HMGB1) 100ug 1652 € MBS Recombinant Proteins human
GENTAUR-58b8a98ca251a Callicebus moloch High mobility group protein B1 (HMGB1) 1000ug 1652 € MBS Recombinant Proteins human
GENTAUR-58b8a98d21c8e Callicebus moloch High mobility group protein B1 (HMGB1) 100ug 2166 € MBS Recombinant Proteins human
GENTAUR-58b8a98d8c4b6 Callicebus moloch High mobility group protein B1 (HMGB1) 1000ug 2166 € MBS Recombinant Proteins human
GENTAUR-58bcf224a8cd6 Cricetulus griseus High mobility group protein B1 (HMGB1) 100ug 1575 € MBS Recombinant Proteins human
GENTAUR-58bcf22507053 Cricetulus griseus High mobility group protein B1 (HMGB1) 1000ug 1575 € MBS Recombinant Proteins human
GENTAUR-58bcf2255295e Cricetulus griseus High mobility group protein B1 (HMGB1) 100ug 2078 € MBS Recombinant Proteins human
GENTAUR-58bcf2259ec82 Cricetulus griseus High mobility group protein B1 (HMGB1) 1000ug 2078 € MBS Recombinant Proteins human
AE39880HO-48 ELISA test for Horse High mobility group protein B1 (HMGB1) 1x plate of 48 wells 402 € abebio horse
AE39877PI-48 ELISA test for Pig High mobility group protein B1 (HMGB1) 1x plate of 48 wells 402 € abebio pig
MBS612185 HMG1 (HMGB1, High Mobility Group, HMG Transcription Factor Box1, Amphoterin, Sulfoglucuronyl Carbohydrate Binding Protein, SBP-1, HMG3) Antibody 200ug 702 € MBS Polyclonals_1 human
MBS618169 HMG1 (HMGB1, High Mobility Group, HMG Transcription Factor Box1, Amphoterin, Sulfoglucuronyl Carbohydrate Binding Protein, SBP-1, HMG3) Antibody 100ul 636 € MBS Polyclonals_1 human
AE39880HO-96 Horse High mobility group protein B1 (HMGB1) ELISA Kit 1x plate of 96 wells 671 € abebio horse
GENTAUR-58b815af88514 Papio anubis High mobility group protein B1 (HMGB1) 100ug 1652 € MBS Recombinant Proteins human
GENTAUR-58b815afeb714 Papio anubis High mobility group protein B1 (HMGB1) 1000ug 1652 € MBS Recombinant Proteins human
GENTAUR-58b815b0581dd Papio anubis High mobility group protein B1 (HMGB1) 100ug 2166 € MBS Recombinant Proteins human
GENTAUR-58b815b0bd7b4 Papio anubis High mobility group protein B1 (HMGB1) 1000ug 2166 € MBS Recombinant Proteins human
GENTAUR-58b83f1ad0da8 Papio anubis High mobility group protein B1 (HMGB1) 100ug 1652 € MBS Recombinant Proteins human
GENTAUR-58b83f1b3d22c Papio anubis High mobility group protein B1 (HMGB1) 1000ug 1652 € MBS Recombinant Proteins human
GENTAUR-58b83f1b9f82f Papio anubis High mobility group protein B1 (HMGB1) 100ug 2166 € MBS Recombinant Proteins human
GENTAUR-58b83f1befc57 Papio anubis High mobility group protein B1 (HMGB1) 1000ug 2166 € MBS Recombinant Proteins human