Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3, HER3 (C-Fc)

Contact us
Catalog number: CD93
Price: 591 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3, HER3 (C-Fc)
Quantity: 100ug
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human ErbB3 is produced by our Mammalian expression system and the target gene encoding Ser20-Cys331 is expressed with a Fc tag at the C-terminus
Molecular Weight: 6 kD, 61
UniProt number: P21860
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAFVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HER3 (C-Fc), Receptor Tyrosine-Protein Kinase ErbB-3
Short name: HER3 (C-Fc), Recombinant Receptor Tyrosine-Protein Kinase ErbB-3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: HER3 (C-fragment c), sapiens Receptor Tyrosine-Protein phosphorylation catalyst ErbB-3, recombinant H
Alternative technique: rec
Identity: 3431
Gene: ERBB3 | More about : ERBB3
Long gene name: erb-b2 receptor tyrosine kinase 3
Synonyms gene: LCCS2
Synonyms gene name: lethal congenital contracture syndrome 2 v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3
Synonyms: HER3
Synonyms name: human epidermal growth factor receptor 3
Locus: 12q13, 2
Discovery year: 1990-07-15
GenBank acession: M34309
Entrez gene record: 2065
RefSeq identity: NM_001982
Classification: Erb-b2 receptor tyrosine kinases
Havana BLAST/BLAT: OTTHUMG00000170140
Locus Specific Databases: LRG_996

Related Products :

CD93 Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3, HER3 (C-Fc) 500 µg 1613 € novo human
MBS624173 EGFR, phosphorylated (Tyr1172) (Epidermal Growth Factor Receptor, Receptor Tyrosine-protein Kinase ErbB-1, Proto-oncogene c-ErbB-1, ERBB1) Antibody 200ul 597 € MBS Polyclonals_1 human
MBS624534 EGFR, phosphorylated (Tyr1197) (Epidermal Growth Factor Receptor, Proto-oncogene c-ErbB-1, Receptor Tyrosine-protein Kinase erbB-1, ERBB1) Antibody 50ug 481 € MBS Polyclonals_1 human
GWB-5A7256 ERBB-3 Receptor protein Tyrosine Kinase (Her3) (ERBB3) Goat antibody to or anti-Human Polyclonal (C- terminus) antibody 1 x 1 vial 602 € genways human
MBS618949 EPHB2 (Ephrin Type-B Receptor 2, Tyrosine-protein Kinase Receptor EPH-3, DRT, Receptor Protein-Tyrosine Kinase HEK5, ERK, EPH-like Kinase 5, EK5, Tyrosine-protein Kinase TYRO5, Renal Carcinoma Antigen NY-REN-47, DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5) 100ug 735 € MBS Polyclonals_1 human
MBS624025 EphB2, NT (Ephrin Type-B Receptor 2, Tyrosine-protein Kinase Receptor EPH-3, DRT, Receptor Protein-Tyrosine Kinase HEK5, ERK, EPH-like Kinase 5, EK5, Tyrosine-protein Kinase TYRO5, Renal Carcinoma Antigen NY-REN-47, DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS618560 ROR2 (Receptor Tyrosine Kinase-like Orphan Receptor 2, BDB, BDB1, MGC163394, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2, Tyrosine-protein Kinase Transmembrane Receptor ROR2) Antibody 100ul 564 € MBS Polyclonals_1 human
MBS621407 TrkB (Tyrosine Kinase Receptor B) (BDNF/NT-3 growth factors receptor, Neurotrophic tyrosine kinase receptor type 2, TrkB tyrosine kinase, GP145-TrkB/GP95-TrkB, Trk-B) (Ntrk2) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS621077 TrkA (Tyrosine Kinase Receptor A) (High affinity nerve growth factor receptor, Neurotrophic tyrosine kinase receptor type 1, TRK1 transforming tyrosine kinase protein, p140-TrkA, Trk-A, GENE NAME: NTRK1, TRK) 100ul 652 € MBS Polyclonals_1 human
CP69 Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-2, HER2 (C-6His) 50 µg 303 € novo human
CD68 Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-2, HER2 (C-Fc) 50 µg 303 € novo human
CH03 Recombinant Rat Receptor Tyrosine-Protein Kinase ErbB-2, ErbB2, HER2 (C-6His) 500 µg 1613 € novo rat
GENTAUR-58be5e5364791 Anti-ErbB-3/HER3 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
MBS622680 c-erbB3, CT (HER 3, ErbB3, ErbB-3, erbB3-S, HER3, LCCS2, MDA-BF-1, MGC88033, p45 sErbB3, p85 sErbB3, p180 ErbB3) Antibody 100ug 636 € MBS Polyclonals_1 human
bs-1454R-A350 ErbB-3/HER3 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1454R-A488 ErbB-3/HER3 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1454R-A555 ErbB-3/HER3 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1454R-A594 ErbB-3/HER3 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1454R-A647 ErbB-3/HER3 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1454R-Biotin ErbB-3/HER3 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1454R ErbB-3/HER3 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-1454R-Cy3 ErbB-3/HER3 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1454R-Cy5 ErbB-3/HER3 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1454R-Cy5.5 ErbB-3/HER3 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1454R-Cy7 ErbB-3/HER3 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1454R-FITC ErbB-3/HER3 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1454R-HRP ErbB-3/HER3 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
MBS616151 MerTK (c-MER, c-Mer Proto-oncogene Tyrosine Kinase, MER, MER Receptor Tyrosine Kinase, MERK, MERPEN, MGC133349, Proto-oncogene Tyrosine Protein Kinase MER, Receptor Tyrosine Kinase MerTK, STK Kinase) Antibody 100ug 868 € MBS Polyclonals_1 human
MBS624009 MerTK (c-MER, c-Mer Proto-oncogene Tyrosine Kinase, MER, MER Receptor Tyrosine Kinase, MGC133349, Proto-oncogene c-Mer, RP38, Tyrosine-protein Kinase Mer) Antibody 200ul 597 € MBS Polyclonals_1 human
MBS612733 Btk (NT) (Bruton Tyrosine Kinase, Bruton's Tyrosine Kinase, Agammaglobulinaemia Tyrosine Kinase, ATK, AGMX1, B cell Progenitor Kinase, BPK, Bruton Agammaglobulinemia Tyrosine Kinase, IMD1, MGC126261, MGC126262, PSCTK1, Tyrosine Protein Kinase BTK, XLA) Antibody 100ug 591 € MBS Polyclonals_1 human