Recombinant Human Interleukin-3, IL-3 (C-6His)

Contact us
Catalog number: CD90
Price: 1613 €
Supplier: novo
Product name: Recombinant Human Interleukin-3, IL-3 (C-6His)
Quantity: 500 µg
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Interleukin-3 is produced by our Mammalian expression system and the target gene encoding Ala20-Phe152 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 16
UniProt number: P08700
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIFVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: IL-3 (C-6His), Interleukin-3
Short name: IL-3 (C-6His), Recombinant Interleukin-3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Interleukin-3 (C-6His), sapiens Interleukin-3, recombinant H
Alternative technique: rec
Identity: 6011
Gene: IL3 | More about : IL3
Long gene name: interleukin 3
Synonyms gene name: interleukin 3 (colony-stimulating factor, multiple)
Synonyms: IL-3 MULTI-CSF MCGF MGC79398 MGC79399
Synonyms name: multilineage-colony-stimulating factor hematopoietic growth factor P-cell stimulating factor mast-cell growth factor colony-stimulating factor, multiple
Locus: 5q31, 1
Discovery year: 2001-06-22
GenBank acession: M14743
Entrez gene record: 3562
Pubmed identfication: 3489530
RefSeq identity: NM_000588
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000059640

Related Products :

C027 Recombinant Human Interleukin-10, IL-10 (N-6His) 10 µg 202 € novo human
CC89 Recombinant Human Interleukin-13, IL-13 (C-6His) 500 µg 1613 € novo human
CS32 Recombinant Human Interleukin-13 Receptor Subunit Alpha-1, IL-13RA1(C-6His) 500 µg 659 € novo human
CI60 Recombinant Human Interleukin-17A, F Heterodimer, IL-17A & IL-17F (C-6His) 1 mg 2486 € novo human
C774 Recombinant Human Interleukin-17A, IL-17A (C-6His) 1 mg 2283 € novo human
CK30 Recombinant Human Interleukin-17B, IL-17B (C-6His) 10 µg 156 € novo human
CA22 Recombinant Human Interleukin-17F, IL-17F (C-6His) 50 µg 369 € novo human
CD72 Recombinant Human Interleukin-18, IL-18, IL-1F4 (C-6His) 50 µg 369 € novo human
CD66 Recombinant Human Interleukin-2, IL-2 (C-6His) 50 µg 202 € novo human
CJ40 Recombinant Human Interleukin-23, IL-23 (C-6His) 1 mg 2486 € novo human
C792 Recombinant Human Interleukin-25, IL-25 (C-6His) 10 µg 156 € novo human
CG64 Recombinant Human Interleukin-25, IL25, MYDGF (N-6His) 50 µg 156 € novo human
CB65 Recombinant Human Interleukin-27, IL-27 (C-6His) 10 µg 232 € novo human
CA25 Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3 (C-6His) 1 mg 2283 € novo human
CD90 Recombinant Human Interleukin-3, IL-3 (C-6His) 1 mg 2283 € novo human
CF63 Recombinant Human Interleukin-3, IL-3 (N-6His) 500 µg 1613 € novo human
C233 Recombinant Human Interleukin-33, IL-33 (N-6His) 500 µg 1613 € novo human
CD88 Recombinant Human Interleukin-4, IL-4 (C-6His) 50 µg 369 € novo human
CS33 Recombinant Human Interleukin-4 Receptor Subunit Alpha, IL-4 Rα(C-6His) 1 mg 1877 € novo human
CI59 Recombinant Human Interleukin-5, IL-5 (C-6His) 10 µg 202 € novo human
CS70 Recombinant Human Interleukin-5 Receptor Subunit Alpha, IL-5 Rα(C-6His) 10 µg 202 € novo human
CD47 Recombinant Human Interleukin-7, IL-7 (C-6His) 10 µg 202 € novo human
CC97 Recombinant Human Interleukin-8, IL-8 (C-6His) 500 µg 1613 € novo human
CA17 Recombinant Human Interleukin-9, IL-9, Cytokine P40 (C-6His) 10 µg 202 € novo human
CG97 Recombinant Cavia porcellus Interleukin-1 Beta, IL-1 beta (C-6His) 1 mg 2283 € novo human
C757 Recombinant Mouse Interleukin-11, IL-11 (C-6His) 500 µg 2283 € novo mouse
CM38 Recombinant Mouse Interleukin-12 Subunit β, IL-12 p40, IL-12B (C-6His) 10 µg 156 € novo human
CD56 Recombinant Mouse Interleukin-13, IL-13 (Pro22-Phe131,C-6His) 500 µg 2217 € novo mouse
CD57 Recombinant Mouse Interleukin-13, IL-13 (Ser26-Phe131,C-6His) 1 mg 3145 € novo mouse
CC11 Recombinant Mouse Interleukin-17F, IL-17F (C-6His) 500 µg 1613 € novo mouse