Recombinant Human Leucine-Rich α-2-Glycoprotein, LRG1 (C-6His)

Contact us
Catalog number: CD80
Price: 963 €
Supplier: novo
Product name: Recombinant Human Leucine-Rich α-2-Glycoprotein, LRG1 (C-6His)
Quantity: 500 µg
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 339€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human LRG1 is produced by our Mammalian expression system and the target gene encoding Val36-Gln347 is expressed with a 6His tag at the C-terminus
Molecular Weight: 3 kD, 35
UniProt number: P02750
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 20 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM Tris, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: LRG1 (C-6His), -2-Glycoprotein, Leucine-Rich &alpha
Short name: LRG1 (C-6His), -2-Glycoprotein, Recombinant Leucine-Rich &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: leucine-rich alpha-2-glycoprotein 1 (C-6His), sapiens Leucine-Rich &alpha, -2-Glycoprotein, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, LRG1 and IDBG-19050 and ENSG00000171236 and 116844, LRG1 and IDBG-644250 and ENSBTAG00000031647 and 514663, Lrg1 and IDBG-191684 and ENSMUSG00000037095 and 76905, protein binding, this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0003674 and molecular function and molecular function this GO :0005160 and transforming growth factor beta receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0008150 and biological process and biological process this GO :0016020 and membrane and cellular component this GO :0030511 and positive regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0050873 and brown fat cell differentiation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003674 : molecular_function, this GO :0003674 : molecular_function and also this GO :0005160 : transforming growth factor beta receptor binding and also this GO :0005515 : protein binding, this GO :0005160 : transforming growth factor beta receptor binding, this GO :0005515 : protein binding, leucine-rich alpha-2-glycoprotein 1
Identity: 29480
Gene: LRG1 | More about : LRG1
Long gene name: leucine rich alpha-2-glycoprotein 1
Synonyms: LRG
Synonyms name: leucine rich alpha 2 glycoprotein
Locus: 19p13, 3
Discovery year: 2004-02-12
Entrez gene record: 116844
Pubmed identfication: 3856868 12223515
RefSeq identity: NM_052972
Havana BLAST/BLAT: OTTHUMG00000182010

Related Products :

CD80 Recombinant Human Leucine-Rich α-2-Glycoprotein, LRG1 (C-6His) 50 µg 339 € novo human
CB74 Recombinant Human Leucine-Rich α-2-Glycoprotein, LRG1 (C-Fc-6His) 50 µg 369 € novo human
MBS613081 PHLPP (PH Domain and Leucine-rich Repeat Protein Phosphatase, PH Domain Leucine-rich Repeat Protein Phosphatase, PH Domain Leucine-rich Repeat-containing Protein Phosphatase, PHLPP1, KIAA0606 Protein, Pleckstrin Homology Domain-containing Family E Protein Antibody 100ul 785 € MBS Polyclonals_1 human
AE35200HU-48 ELISA test for Human Leucine-rich alpha-2 glycoprotein 1 (LRG1) 1x plate of 48 wells 373 € abebio human
AE35200HU Human Leucine-rich alpha-2 glycoprotein 1 (LRG1) ELISA Kit 48 wells plate 480 € ab-elisa elisas human
AE35200HU-96 Human Leucine-rich alpha-2 glycoprotein 1 (LRG1) ELISA Kit 1x plate of 96 wells 612 € abebio human
DL-LRG1-Hu Human Leucine Rich Alpha-2-Glycoprotein 1 LRG1 ELISA Kit 96T 869 € DL elisas human
KT-20509 Human Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) ELISA kit 96 well plate 1113 € Kamiya human
GENTAUR-58bdc549e90a5 Anti- Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc54a9766b Anti- Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdcc675eab9 Anti- Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcc67cca26 Anti- Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdd160667bf Anti- Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd24117735 Anti- Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd969b9d8a Anti- Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddca575853 Anti- Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) Antibody 100ug 575 € MBS Polyclonals human
EKU05603 Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU05604 Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
EKU05605 Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
DL-LRG1-Mu Mouse Leucine Rich Alpha-2-Glycoprotein 1 LRG1 ELISA Kit 96T 904 € DL elisas mouse
DL-LRG1-Ra Rat Leucine Rich Alpha-2-Glycoprotein 1 LRG1 ELISA Kit 96T 962 € DL elisas rat
MBS621390 Synaptic adhesion-like molecule 2 (SALM2, LRFN1, leucine rich repeat and fibronectin type III domain containing 1, KIAA1484, Leucine-rich repeat and fibronectin type III domain-containing protein 1) 100ug 774 € MBS Polyclonals_1 human
C348 Recombinant Human Fibronectin Leucine Rich Transmembrane Protein 1, FLRT1 (C-6His) 500 µg 1613 € novo human
C349 Recombinant Human Fibronectin Leucine Rich Transmembrane Protein 2, FLRT2 (C-6His) 500 µg 1613 € novo human
CJ66 Recombinant Human Leucine-Rich Repeat-Containing Protein 19, LRRC19 (C-6His) 50 µg 496 € novo human
C618 Recombinant Human Leucine-Rich Repeat-Containing Protein 2, LRRN2 (C-6His) 50 µg 369 € novo human
CI35 Recombinant Human Leucine-Rich Repeat-Containing Protein 25, LRRC25 (C-6His) 1 mg 2486 € novo human
C686 Recombinant Human Leucine-Rich Repeat-Containing Protein 3B, LRRC3B (C-6His) 1 mg 2283 € novo human
C970 Recombinant Human Leucine-Rich Repeat Transmembrane Protein FLRT3, FLRT3 (C-6His) 50 µg 369 € novo human
CS94 Recombinant Mouse Leucine-rich Repeats and IG-like Domains Protein 1, LRIG1 (C-6His) 500 µg 963 € novo mouse