Recombinant Human Clusterin-Like Protein 1, CLUL1 (C-6His)

Contact us
Catalog number: CA55
Price: 202 €
Supplier: novo
Product name: Recombinant Human Clusterin-Like Protein 1, CLUL1 (C-6His)
Quantity: 10 µg
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Clusterin-Like Protein 1 is produced by our Mammalian expression system and the target gene encoding Ala21-Ala442 is expressed with a 6His tag at the C-terminus
Molecular Weight: 06 kD, 50
UniProt number: Q15846
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNCMRIYTTCQPSWSSVKNKIERFFRKIYQFLFPFHEDNEKDLPISEKLIEEDAQLTQMEDVFSQLTVDVNSLFNRSFNVFRQMQQEFDQTFQSHFISDTDLTEPYFFPAFSKEPMTKADLEQCWDIPNFFQLFCNFSVSIYESVSETITKMLKAIEDLPKQDKAPDHGGLISKMLPGQDRGLCGELDQNLSRCFKFHEKCQKCQAHLSEDCPDVPALHTELDEAIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAPETEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CLUL1 (C-6His), Clusterin-Like Protein 1
Short name: CLUL1 (C-6His), Recombinant Clusterin-Like Protein 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CLUL1 (C-6His), sapiens Clusterin-Like Protein 1, recombinant H
Alternative technique: rec
Identity: 2096
Gene: CLUL1 | More about : CLUL1
Long gene name: clusterin like 1
Synonyms gene name: clusterin-like 1 (retinal)
Synonyms name: retinal clusterin-like protein
Locus: 18p11, 32
Discovery year: 2000-05-30
GenBank acession: D63813
Entrez gene record: 27098
Pubmed identfication: 10675623 14507903
Havana BLAST/BLAT: OTTHUMG00000178252

Related Products :

CA55 Recombinant Human Clusterin-Like Protein 1, CLUL1 (C-6His) 10 µg 202 € novo human
C454 Recombinant Human Clusterin, ApoJ (C-6His) 10 µg 131 € novo human
CD33 Recombinant Human Clusterin, ApoJ (C-Fc-6His) 10 µg 146 € novo human
CI14 Recombinant Mouse Clusterin, APOJ (C-6His) 1 mg 2283 € novo mouse
LV121405 CLUL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV121406 CLUL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV121407 CLUL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV121408 CLUL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV121410 CLUL1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV121409 CLUL1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58be30706360f Anti- CLUL1 Antibody 0.2 ml 603 € MBS Polyclonals human
abx912156 Anti-CLUL1 siRNA 15 nmol 528 € abbex human
abx912157 Anti-CLUL1 siRNA inquire 50 € abbex human
GWB-MT675I CLUL1 antibody 1 vial 521 € genways human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
APOJ36-R-10 Recombinant (HEK 293) purified Human ApoJ (Clusterin/Apolipoprotein J) protein for ELISA 10 μg 478 € adi human
RP-0439H Recombinant Human Clusterin / Apolipoprotein J / Apo-J / CLU Protein (His Tag) 50μg 624 € adv human
APOJ11-C Recombinant purified Human ApoJ (Clusterin/Apolipoprotein J) protein control for WB 100 μL 333 € adi human
abx167805 Anti-Clusterin Protein (Recombinant) 50 μg 644 € abbex human
abx168004 Anti-Clusterin Protein (Recombinant) 100 μg 891 € abbex human
APOJ35-R-10 Recombinant (E.Coli) purified Rat ApoJ (Clusterin/Apolipoprotein J) protein for ELISA 10 μg 478 € adi rat
RP-1196M Recombinant Mouse Clusterin / Apolipoprotein J / Apo-J / CLU Protein (His Tag) 50μg 624 € adv mouse
C527 Recombinant Human Protein Disulfide-Isomerase-Like Protein of the Testis, PDILT (C-6His) 50 µg 369 € novo human
CH76 Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein, OASLOASL (C-6His) 10 µg 202 € novo human
CC55 Recombinant Human ADAM-like Protein Decysin-1, ADAMDEC1 (C-6His) 10 µg 146 € novo human
CS81 Recombinant Human Amyloid-like Protein 1, APLP-1 (C-6His) 500 µg 1328 € novo human
CH21 Recombinant Human Angiopoietin-Like Protein 8, ANGPTL8, Betatrophin (C-6His) 1 mg 2486 € novo human
CF02 Recombinant Human BAX, Bcl-2-Like Protein 4, BCL2L4 (N, C-6His) 1 mg 2486 € novo human
C104 Recombinant Human Bcl-2-Like Protein 1, BCL2L1 (C-6His) 50 µg 369 € novo human
CR24 Recombinant Human Bcl-2-like Protein 11, BIML (N-6His) 10 µg 202 € novo human