| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human PPIase FKBP7 is produced by our Mammalian expression system and the target gene encoding Gln24-Leu222 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
23, 94 kD |
| UniProt number: |
Q9Y680 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
1 mM GaCl2, 10%Glycerol, 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDELVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
FKBP7 (C-6His), Peptidyl-Prolyl Cis-Trans Isomerase FKBP7 |
| Short name: |
FKBP7 (C-6His), Recombinant Peptidyl-Prolyl Cis-Trans Isomerase FKBP7 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
FK506 binding protein 7 (C-6His), sapiens Peptidyl-Prolyl Cis-Trans Isomerase FK506 binding protein 7, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Cytoplasm, FK506 binding, FKBP7 and IDBG-640202 and ENSBTAG00000001097 and 509422, FKBP7 and IDBG-76052 and ENSG00000079150 and 51661, Fkbp7 and IDBG-182182 and ENSMUSG00000002732 and 14231, this GO :0000413 and protein peptidyl-prolyl isomerization and biological process this GO :0003755 and peptidyl-prolyl cis-trans isomerase activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005528 and FK506 binding and molecular function this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005788 and endoplasmic reticulum lumen and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0006457 and protein folding and biological process this GO :0061077 and chaperone-mediated protein folding and biological process, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0005528 : FK506 binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0005528 : FK506 binding, FK506 binding protein 7 |
| Identity: |
3723 |
| Gene: |
FKBP7 |
More about : FKBP7 |
| Long gene name: |
FK506 binding protein 7 |
| Synonyms gene name: |
FK506-binding protein 7 |
| Synonyms: |
FKBP23 |
| Locus: |
2q31, 2 |
| Discovery year: |
1998-12-09 |
| GenBank acession: |
AF092137 |
| Entrez gene record: |
51661 |
| Pubmed identfication: |
9806833 |
| RefSeq identity: |
NM_181342 |
| Classification: |
FKBP prolyl isomerases EF-hand domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000132577 |