Recombinant Human Ribonuclease Pancreatic, RNASE1 (C-6His)

Catalog number:	CA30 Buy Now
Price:	1431 €
Supplier:	MBS Recombinant Proteins
Product name:	Recombinant Human Ribonuclease Pancreatic, RNASE1 (C-6His)
Quantity:	100ug
Other quantities:	1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:	human gene rnase recombinant sapiens synonyms alternative source

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Ribonuclease Pancreatic is produced by our Mammalian expression system and the target gene encoding Lys29-Thr156 is expressed with a 6His tag at the C-terminus
Molecular Weight:	15, 6 kD
UniProt number:	P07998
State of the product:	Liquid
Shipping conditions:	Dry ice/ice packs
Formulation:	10% Glycerol, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	KESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTVDHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	RNASE1 (C-6His), Ribonuclease Pancreatic
Short name:	RNASE1 (C-6His), Recombinant Ribonuclease Pancreatic
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	RNASE1 (C-6His), sapiens Ribonuclease Pancreatic, recombinant H
Alternative technique:	rec
Identity:	10044
Gene:	RNASE1 | More about : RNASE1
Long gene name:	pancreatic , ribonuclease A family member 1
Synonyms gene:	RNS1
Synonyms gene name:	1 (pancreatic) , RNase A family, ribonuclease
Synonyms:	RAC1
Locus:	14q11, 2
Discovery year:	1990-02-24
GenBank acession:	BC005324
Entrez gene record:	6035
Pubmed identfication:	8588814
Classification:	Ribonuclease A family
Havana BLAST/BLAT:	OTTHUMG00000029603

• #human
• #gene
• #rnase
• #recombinant
• #sapiens
• #synonyms
• #alternative
• #source