| Catalog number: | CA30 |
|---|---|
| Price: | 1431 € |
| Supplier: | MBS Recombinant Proteins |
| Product name: | Recombinant Human Ribonuclease Pancreatic, RNASE1 (C-6His) |
| Quantity: | 100ug |
| Other quantities: | 10 µg 202€ 50 µg 496€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Ribonuclease Pancreatic is produced by our Mammalian expression system and the target gene encoding Lys29-Thr156 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 15, 6 kD |
| UniProt number: | P07998 |
| State of the product: | Liquid |
| Shipping conditions: | Dry ice/ice packs |
| Formulation: | 10% Glycerol, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0 |
| Storage recommendations: | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | KESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTVDHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | RNASE1 (C-6His), Ribonuclease Pancreatic |
| Short name: | RNASE1 (C-6His), Recombinant Ribonuclease Pancreatic |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | RNASE1 (C-6His), sapiens Ribonuclease Pancreatic, recombinant H |
| Alternative technique: | rec |
| Identity: | 10044 |
| Gene: | RNASE1 | More about : RNASE1 |
| Long gene name: | pancreatic , ribonuclease A family member 1 |
| Synonyms gene: | RNS1 |
| Synonyms gene name: | 1 (pancreatic) , RNase A family, ribonuclease |
| Synonyms: | RAC1 |
| Locus: | 14q11, 2 |
| Discovery year: | 1990-02-24 |
| GenBank acession: | BC005324 |
| Entrez gene record: | 6035 |
| Pubmed identfication: | 8588814 |
| Classification: | Ribonuclease A family |
| Havana BLAST/BLAT: | OTTHUMG00000029603 |
| CA30 | Recombinant Human Ribonuclease Pancreatic, RNASE1 (C-6His) | 10 µg | 202 € | novo | human |
| GENTAUR-58b8afb4f049d | Aepyceros melampus Ribonuclease pancreatic (RNASE1) | 100ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8afb56045d | Aepyceros melampus Ribonuclease pancreatic (RNASE1) | 1000ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8afb5d3e3d | Aepyceros melampus Ribonuclease pancreatic (RNASE1) | 100ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8afb634035 | Aepyceros melampus Ribonuclease pancreatic (RNASE1) | 1000ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58bcd962d4970 | Alces alces alces Ribonuclease pancreatic (RNASE1) | 100ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58bcd9631d7f3 | Alces alces alces Ribonuclease pancreatic (RNASE1) | 1000ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58bcd963697ef | Alces alces alces Ribonuclease pancreatic (RNASE1) | 100ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58bcd963ad81c | Alces alces alces Ribonuclease pancreatic (RNASE1) | 1000ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba2eef22e94 | Antilocapra americana Ribonuclease pancreatic (RNASE1) | 100ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba2eef782ba | Antilocapra americana Ribonuclease pancreatic (RNASE1) | 1000ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba2ef06227a | Antilocapra americana Ribonuclease pancreatic (RNASE1) | 100ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba2ef111186 | Antilocapra americana Ribonuclease pancreatic (RNASE1) | 1000ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c44327907 | Axis porcinus Ribonuclease pancreatic (RNASE1) | 100ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c44386b69 | Axis porcinus Ribonuclease pancreatic (RNASE1) | 1000ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c443ebcb9 | Axis porcinus Ribonuclease pancreatic (RNASE1) | 100ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c4444620b | Axis porcinus Ribonuclease pancreatic (RNASE1) | 1000ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc9fc19835c | Balaenoptera acutorostrata Ribonuclease pancreatic (RNASE1) | 100ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc9fc1e8185 | Balaenoptera acutorostrata Ribonuclease pancreatic (RNASE1) | 1000ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc9fc242126 | Balaenoptera acutorostrata Ribonuclease pancreatic (RNASE1) | 100ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc9fc2939b7 | Balaenoptera acutorostrata Ribonuclease pancreatic (RNASE1) | 1000ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba693c05eb9 | Bison bison Ribonuclease pancreatic (RNASE1) | 100ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba693ca8843 | Bison bison Ribonuclease pancreatic (RNASE1) | 1000ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba693e058e0 | Bison bison Ribonuclease pancreatic (RNASE1) | 100ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba693fbbb5f | Bison bison Ribonuclease pancreatic (RNASE1) | 1000ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8339bb27ba | Boselaphus tragocamelus Ribonuclease pancreatic (RNASE1) | 100ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8339c1b206 | Boselaphus tragocamelus Ribonuclease pancreatic (RNASE1) | 1000ug | 1431 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8339c9d740 | Boselaphus tragocamelus Ribonuclease pancreatic (RNASE1) | 100ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8339d30a84 | Boselaphus tragocamelus Ribonuclease pancreatic (RNASE1) | 1000ug | 1934 € | MBS Recombinant Proteins | human |
| GENTAUR-58bb7d2dc9cf8 | Camelus bactrianus Ribonuclease pancreatic (RNASE1) | 100ug | 1431 € | MBS Recombinant Proteins | human |