Recombinant Human Ribonuclease Pancreatic, RNASE1 (C-6His)

Contact us
Catalog number: CA30
Price: 1431 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Ribonuclease Pancreatic, RNASE1 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Ribonuclease Pancreatic is produced by our Mammalian expression system and the target gene encoding Lys29-Thr156 is expressed with a 6His tag at the C-terminus
Molecular Weight: 15, 6 kD
UniProt number: P07998
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% Glycerol, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: RNASE1 (C-6His), Ribonuclease Pancreatic
Short name: RNASE1 (C-6His), Recombinant Ribonuclease Pancreatic
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: RNASE1 (C-6His), sapiens Ribonuclease Pancreatic, recombinant H
Alternative technique: rec
Identity: 10044
Gene: RNASE1 | More about : RNASE1
Long gene name: pancreatic , ribonuclease A family member 1
Synonyms gene: RNS1
Synonyms gene name: 1 (pancreatic) , RNase A family, ribonuclease
Synonyms: RAC1
Locus: 14q11, 2
Discovery year: 1990-02-24
GenBank acession: BC005324
Entrez gene record: 6035
Pubmed identfication: 8588814
Classification: Ribonuclease A family
Havana BLAST/BLAT: OTTHUMG00000029603

Related Products :

CA30 Recombinant Human Ribonuclease Pancreatic, RNASE1 (C-6His) 10 µg 202 € novo human
GENTAUR-58b8afb4f049d Aepyceros melampus Ribonuclease pancreatic (RNASE1) 100ug 1431 € MBS Recombinant Proteins human
GENTAUR-58b8afb56045d Aepyceros melampus Ribonuclease pancreatic (RNASE1) 1000ug 1431 € MBS Recombinant Proteins human
GENTAUR-58b8afb5d3e3d Aepyceros melampus Ribonuclease pancreatic (RNASE1) 100ug 1934 € MBS Recombinant Proteins human
GENTAUR-58b8afb634035 Aepyceros melampus Ribonuclease pancreatic (RNASE1) 1000ug 1934 € MBS Recombinant Proteins human
GENTAUR-58bcd962d4970 Alces alces alces Ribonuclease pancreatic (RNASE1) 100ug 1431 € MBS Recombinant Proteins human
GENTAUR-58bcd9631d7f3 Alces alces alces Ribonuclease pancreatic (RNASE1) 1000ug 1431 € MBS Recombinant Proteins human
GENTAUR-58bcd963697ef Alces alces alces Ribonuclease pancreatic (RNASE1) 100ug 1934 € MBS Recombinant Proteins human
GENTAUR-58bcd963ad81c Alces alces alces Ribonuclease pancreatic (RNASE1) 1000ug 1934 € MBS Recombinant Proteins human
GENTAUR-58ba2eef22e94 Antilocapra americana Ribonuclease pancreatic (RNASE1) 100ug 1431 € MBS Recombinant Proteins human
GENTAUR-58ba2eef782ba Antilocapra americana Ribonuclease pancreatic (RNASE1) 1000ug 1431 € MBS Recombinant Proteins human
GENTAUR-58ba2ef06227a Antilocapra americana Ribonuclease pancreatic (RNASE1) 100ug 1934 € MBS Recombinant Proteins human
GENTAUR-58ba2ef111186 Antilocapra americana Ribonuclease pancreatic (RNASE1) 1000ug 1934 € MBS Recombinant Proteins human
GENTAUR-58b9c44327907 Axis porcinus Ribonuclease pancreatic (RNASE1) 100ug 1431 € MBS Recombinant Proteins human
GENTAUR-58b9c44386b69 Axis porcinus Ribonuclease pancreatic (RNASE1) 1000ug 1431 € MBS Recombinant Proteins human
GENTAUR-58b9c443ebcb9 Axis porcinus Ribonuclease pancreatic (RNASE1) 100ug 1934 € MBS Recombinant Proteins human
GENTAUR-58b9c4444620b Axis porcinus Ribonuclease pancreatic (RNASE1) 1000ug 1934 € MBS Recombinant Proteins human
GENTAUR-58bc9fc19835c Balaenoptera acutorostrata Ribonuclease pancreatic (RNASE1) 100ug 1431 € MBS Recombinant Proteins human
GENTAUR-58bc9fc1e8185 Balaenoptera acutorostrata Ribonuclease pancreatic (RNASE1) 1000ug 1431 € MBS Recombinant Proteins human
GENTAUR-58bc9fc242126 Balaenoptera acutorostrata Ribonuclease pancreatic (RNASE1) 100ug 1934 € MBS Recombinant Proteins human
GENTAUR-58bc9fc2939b7 Balaenoptera acutorostrata Ribonuclease pancreatic (RNASE1) 1000ug 1934 € MBS Recombinant Proteins human
GENTAUR-58ba693c05eb9 Bison bison Ribonuclease pancreatic (RNASE1) 100ug 1431 € MBS Recombinant Proteins human
GENTAUR-58ba693ca8843 Bison bison Ribonuclease pancreatic (RNASE1) 1000ug 1431 € MBS Recombinant Proteins human
GENTAUR-58ba693e058e0 Bison bison Ribonuclease pancreatic (RNASE1) 100ug 1934 € MBS Recombinant Proteins human
GENTAUR-58ba693fbbb5f Bison bison Ribonuclease pancreatic (RNASE1) 1000ug 1934 € MBS Recombinant Proteins human
GENTAUR-58b8339bb27ba Boselaphus tragocamelus Ribonuclease pancreatic (RNASE1) 100ug 1431 € MBS Recombinant Proteins human
GENTAUR-58b8339c1b206 Boselaphus tragocamelus Ribonuclease pancreatic (RNASE1) 1000ug 1431 € MBS Recombinant Proteins human
GENTAUR-58b8339c9d740 Boselaphus tragocamelus Ribonuclease pancreatic (RNASE1) 100ug 1934 € MBS Recombinant Proteins human
GENTAUR-58b8339d30a84 Boselaphus tragocamelus Ribonuclease pancreatic (RNASE1) 1000ug 1934 € MBS Recombinant Proteins human
GENTAUR-58bb7d2dc9cf8 Camelus bactrianus Ribonuclease pancreatic (RNASE1) 100ug 1431 € MBS Recombinant Proteins human