| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human High Mobility Group Protein B2 is produced by our Mammalian expression system and the target gene encoding Gly2-Glu209 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
07 kD, 25 |
| UniProt number: |
P26583 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEEVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
HMGB2 (C-6His), Mobility Group Protein B2 |
| Short name: |
HMGB2 (C-6His), Recombinant High Mobility Group Protein B2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
high mobility family box 2 (C-6His), sapiens High Mobility family Protein B2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
DNA binding, DNA ligation and biological process this GO :0006309 and apoptotic DNA fragmentation and biological process this GO :0006325 and chromatin organization and biological process this GO :0006334 and nucleosome assembly and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006915 and apoptotic process and biological process this GO :0006921 and cellular component disassembly involved in execution phase of apoptosis and biological process this GO :0007283 and spermatogenesis and biological process this GO :0007289 and spermatid nucleus differentiation and biological process this GO :0008301 and DNA binding, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048545 and response to steroid hormone and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0050918 and positive chemotaxis and biological process this GO :0051103 and DNA ligation involved in DNA repair and biological process this GO :0060326 and cell chemotaxis and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :1902042 and negative regulation of extrinsic apoptotic signaling pathway via death domain receptors and biological process, HMG2, HMGB2 and IDBG-44657 and ENSG00000164104 and 3148, HMGB2 and IDBG-629304 and ENSBTAG00000015101 and 540444, Hmgb2 and IDBG-156235 and ENSMUSG00000054717 and 97165, bending, bending and also this GO :0019904 : protein domain specific binding and also this GO :0042056 : chemoattractant activity and also this GO :0044212 : transcription regulatory region DNA binding and also this GO :0044822 : poly(A) RNA binding and also this GO :0050786 : RAGE receptor binding, bending and molecular function this GO :0008584 and male this GO nad development and biological process this GO :0019904 and protein domain specific binding and molecular function this GO :0032075 and positive regulation of nuclease activity and biological process this GO :0033151 and V(D)J recombination and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0043234 and protein complex and cellular component this GO :0043388 and positive regulation of DNA binding and biological process this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045648 and positive regulation of erythrocyte differentiation and biological process this GO :0045654 and positive regulation of megakaryocyte differentiation and biological process this GO :0045892 and negative regulation of transcription, nuclei, this GO :0000793 and condensed chromosome and cellular component this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0003677 and DNA binding and molecular function this GO :0003684 and damaged DNA binding and molecular function this GO :0003690 and double-stranded DNA binding and molecular function this GO :0003697 and single-stranded DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006265 and DNA topological change and biological process this GO :0006288 and base-excision repair, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003684 : damaged DNA binding and also this GO :0003690 : double-stranded DNA binding and also this GO :0003697 : single-stranded DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding and also this GO :0008301 : DNA binding, this GO :0003684 : damaged DNA binding, this GO :0003690 : double-stranded DNA binding, this GO :0003697 : single-stranded DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, this GO :0008301 : DNA binding, this GO :0019904 : protein domain specific binding, this GO :0042056 : chemoattractant activity, this GO :0044212 : transcription regulatory region DNA binding, this GO :0044822 : poly(A) RNA binding, this GO :0050786 : RAGE receptor binding, 618297, high mobility group box 2 |
| Identity: |
5000 |
| Gene: |
HMGB2 |
More about : HMGB2 |
| Long gene name: |
high mobility group box 2 |
| Synonyms gene: |
HMG2 |
| Synonyms gene name: |
high-mobility group (nonhistone chromosomal) protein 2 high-mobility group box 2 |
| Locus: |
4q34, 1 |
| Discovery year: |
1993-12-13 |
| Entrez gene record: |
3148 |
| Pubmed identfication: |
1754403 |
| RefSeq identity: |
NM_001130688 |
| Classification: |
Canonical high mobility group |
| Havana BLAST/BLAT: |
OTTHUMG00000160799 |