Recombinant Human High Mobility Group Protein B2, HMGB2 (C-6His)

Contact us
Catalog number: C987
Price: 1591 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human High Mobility Group Protein B2, HMGB2 (C-6His)
Quantity: 100ug
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human High Mobility Group Protein B2 is produced by our Mammalian expression system and the target gene encoding Gly2-Glu209 is expressed with a 6His tag at the C-terminus
Molecular Weight: 07 kD, 25
UniProt number: P26583
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEEVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HMGB2 (C-6His), Mobility Group Protein B2
Short name: HMGB2 (C-6His), Recombinant High Mobility Group Protein B2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: high mobility family box 2 (C-6His), sapiens High Mobility family Protein B2, recombinant H
Alternative technique: rec
Alternative to gene target: DNA binding, DNA ligation and biological process this GO :0006309 and apoptotic DNA fragmentation and biological process this GO :0006325 and chromatin organization and biological process this GO :0006334 and nucleosome assembly and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006915 and apoptotic process and biological process this GO :0006921 and cellular component disassembly involved in execution phase of apoptosis and biological process this GO :0007283 and spermatogenesis and biological process this GO :0007289 and spermatid nucleus differentiation and biological process this GO :0008301 and DNA binding, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048545 and response to steroid hormone and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0050918 and positive chemotaxis and biological process this GO :0051103 and DNA ligation involved in DNA repair and biological process this GO :0060326 and cell chemotaxis and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :1902042 and negative regulation of extrinsic apoptotic signaling pathway via death domain receptors and biological process, HMG2, HMGB2 and IDBG-44657 and ENSG00000164104 and 3148, HMGB2 and IDBG-629304 and ENSBTAG00000015101 and 540444, Hmgb2 and IDBG-156235 and ENSMUSG00000054717 and 97165, bending, bending and also this GO :0019904 : protein domain specific binding and also this GO :0042056 : chemoattractant activity and also this GO :0044212 : transcription regulatory region DNA binding and also this GO :0044822 : poly(A) RNA binding and also this GO :0050786 : RAGE receptor binding, bending and molecular function this GO :0008584 and male this GO nad development and biological process this GO :0019904 and protein domain specific binding and molecular function this GO :0032075 and positive regulation of nuclease activity and biological process this GO :0033151 and V(D)J recombination and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0043234 and protein complex and cellular component this GO :0043388 and positive regulation of DNA binding and biological process this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045648 and positive regulation of erythrocyte differentiation and biological process this GO :0045654 and positive regulation of megakaryocyte differentiation and biological process this GO :0045892 and negative regulation of transcription, nuclei, this GO :0000793 and condensed chromosome and cellular component this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0003677 and DNA binding and molecular function this GO :0003684 and damaged DNA binding and molecular function this GO :0003690 and double-stranded DNA binding and molecular function this GO :0003697 and single-stranded DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006265 and DNA topological change and biological process this GO :0006288 and base-excision repair, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003684 : damaged DNA binding and also this GO :0003690 : double-stranded DNA binding and also this GO :0003697 : single-stranded DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding and also this GO :0008301 : DNA binding, this GO :0003684 : damaged DNA binding, this GO :0003690 : double-stranded DNA binding, this GO :0003697 : single-stranded DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, this GO :0008301 : DNA binding, this GO :0019904 : protein domain specific binding, this GO :0042056 : chemoattractant activity, this GO :0044212 : transcription regulatory region DNA binding, this GO :0044822 : poly(A) RNA binding, this GO :0050786 : RAGE receptor binding, 618297, high mobility group box 2
Identity: 5000
Gene: HMGB2 | More about : HMGB2
Long gene name: high mobility group box 2
Synonyms gene: HMG2
Synonyms gene name: high-mobility group (nonhistone chromosomal) protein 2 high-mobility group box 2
Locus: 4q34, 1
Discovery year: 1993-12-13
Entrez gene record: 3148
Pubmed identfication: 1754403
RefSeq identity: NM_001130688
Classification: Canonical high mobility group
Havana BLAST/BLAT: OTTHUMG00000160799

Related Products :

MBS610453 HMG4 (High Mobility Group 4 (HMG) Transcription Factor, High Mobility Group Protein 2a, HMG2a, High Mobility Group Box 3, HMGB3, MGC90319, Nonhistone Chromosomal Protein HMG4) Antibody 100ul 785 € MBS Polyclonals_1 human
C987 Recombinant Human High Mobility Group Protein B2, HMGB2 (C-6His) 1 mg 2283 € novo human
MBS612981 HMG17, HMGN2 (High Mobility Group (HMG) Transcription Factor, High Mobility Group Nucleosomal Binding Domain 2) Antibody 50ug 382 € MBS Polyclonals_1 human
GENTAUR-58b8a3eb23d37 Arabidopsis thaliana High mobility group B protein 2 (HMGB2) 100ug 1481 € MBS Recombinant Proteins human
GENTAUR-58b8a3eb862b9 Arabidopsis thaliana High mobility group B protein 2 (HMGB2) 1000ug 1481 € MBS Recombinant Proteins human
GENTAUR-58b8a3ec092e6 Arabidopsis thaliana High mobility group B protein 2 (HMGB2) 100ug 1984 € MBS Recombinant Proteins human
GENTAUR-58b8a3ec6dbb0 Arabidopsis thaliana High mobility group B protein 2 (HMGB2) 1000ug 1984 € MBS Recombinant Proteins human
AE39871PI-48 ELISA test for Pig High mobility group protein B2 (HMGB2) 1x plate of 48 wells 402 € abebio pig
AE39871PI-96 Pig High mobility group protein B2 (HMGB2) ELISA Kit 1x plate of 96 wells 671 € abebio pig
C357 Recombinant Human High Mobility Group Protein B1, HMGB1 (C-6His) 500 µg 1613 € novo human
C910 Recombinant Human High Mobility Group Protein B3, HMGB3 (C-6His) 500 µg 1613 € novo human
CE66 Recombinant Human High Mobility Group Protein B1, HMGB1 1 mg 2283 € novo human
CH67 Recombinant Human High Mobility Group Protein B1, HMGB1 (N-MARI) 10 µg 156 € novo human
RP-991 Recombinant (E.Coli, His-tag) Human High-Mobility Group Box 1 (HMGB-1) 10 μg 260 € adi human
RP-991-2 Recombinant (HEK) Human High-Mobility Group Box 1 (1-215aa, HMGB-1/HMG-1/HMG3/SBP-1) (>95%, his-tag), active 10 μg 405 € adi human
GWB-BA1B86 Recombinant Human High Mobility Group Box Hi-5 bulk Ask price € genways bulk human
abx166019 Anti-High Mobility Group Protein 2 Like Protein 1 (Recombinant) 10 μg 412 € abbex human
abx262909 Anti-High Mobility Group AT-Hook 1 Protein (Recombinant) 10 µg 340 € abbex human
abx263353 Anti-High Mobility Group AT-Hook 2 Protein (Recombinant) 2 µg 238 € abbex human
abx261998 Anti-High-Mobility Group Box 1 Hi-5 Insect Cells Protein (Recombinant) 20 µg 340 € abbex insect
abx260452 Anti-High-Mobility Group Box 1 Protein (Recombinant) 50 µg 340 € abbex human
abx262026 Anti-High-Mobility Group Box 2 Protein (Recombinant) 20 µg 340 € abbex human
abx261134 Anti-High-Mobility Group Box 3 Protein (Recombinant) 1 mg 3559 € abbex human
abx167921 Anti-High Mobility Group Box Protein 2 (Recombinant) 10 μg 412 € abbex human
abx261358 Anti-High Mobility Group Nucleosomal Binding Domain 3 Protein (Recombinant) 20 µg 340 € abbex human
abx262886 Anti-High-Mobility Group Nucleosome Binding Domain 1 Protein (Recombinant) 1 mg 6662 € abbex human
abx167884 Anti-High Mobility Group Protein 1 (Recombinant) 10 μg 412 € abbex human
abx167885 Anti-High Mobility Group Protein 1 (Recombinant) 10 μg 528 € abbex human
abx166020 Anti-High Mobility Group Protein 17 (Recombinant) 50 μg 659 € abbex human
GENTAUR-58bb4a900389d Human Putative high mobility group protein B3-like protein 100ug 1591 € MBS Recombinant Proteins human