| Catalog number: | C885 |
|---|---|
| Price: | 50 € |
| Supplier: | abbex |
| Product name: | Recombinant Human Sorbitol Dehydrogenase, SORD (C-6His) |
| Quantity: | inquire |
| Other quantities: | 1 mg 2283€ 10 µg 202€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Sorbitol Dehydrogenase is produced by our Mammalian expression system and the target gene encoding Ala2-Pro357 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 3 kD, 39 |
| UniProt number: | Q00796 |
| State of the product: | Liquid |
| Shipping conditions: | Dry ice/ice packs |
| Formulation: | 2 um filtered solution of 20 mM TrisHCl, 20% glycerol, 2M sodium chloride, 5 mM DTT, Supplied as a 0, pH8 |
| Storage recommendations: | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNPVDHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | SORD (C-6His), Sorbitol Dehydrogenase |
| Short name: | SORD (C-6His), Recombinant Sorbitol Dehydrogenase |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | SORD (C-6His), sapiens Sorbitol Dehydrogenase, recombinant H |
| Alternative technique: | rec |
| Identity: | 3829 |
| Gene: | FRA10A | More about : FRA10A |
| Long gene name: | folic acid type, fra(10)(q23, fragile site, rare, 2) , 3) or fra(10)(q24 |
| Locus: | 10q23, 2 , 3 or 10q24 |
| Discovery year: | 1986-01-01 |
| Pubmed identfication: | 15203205 |
| C885 | Recombinant Human Sorbitol Dehydrogenase, SORD (C-6His) | 50 µg | 496 € | novo | human |
| AE17705SH-48 | ELISA test for Sheep Sorbitol dehydrogenase (SORD) | 1x plate of 48 wells | 402 € | abebio | sheep |
| GENTAUR-58bda42d4edeb | Macaca fascicularis Sorbitol dehydrogenase (SORD) | 100ug | 2011 € | MBS Recombinant Proteins | human |
| GENTAUR-58bda42dbbfa8 | Macaca fascicularis Sorbitol dehydrogenase (SORD) | 1000ug | 2011 € | MBS Recombinant Proteins | human |
| GENTAUR-58bda42e45b5d | Macaca fascicularis Sorbitol dehydrogenase (SORD) | 100ug | 2525 € | MBS Recombinant Proteins | human |
| GENTAUR-58bda42ea3fcd | Macaca fascicularis Sorbitol dehydrogenase (SORD) | 1000ug | 2525 € | MBS Recombinant Proteins | human |
| GENTAUR-58bda4ce17de8 | Macaca fascicularis Sorbitol dehydrogenase (SORD) | 100ug | 2011 € | MBS Recombinant Proteins | human |
| GENTAUR-58bda4ce48df5 | Macaca fascicularis Sorbitol dehydrogenase (SORD) | 1000ug | 2011 € | MBS Recombinant Proteins | human |
| GENTAUR-58bda4ce7dd52 | Macaca fascicularis Sorbitol dehydrogenase (SORD) | 100ug | 2525 € | MBS Recombinant Proteins | human |
| GENTAUR-58bda4cf0c5f3 | Macaca fascicularis Sorbitol dehydrogenase (SORD) | 1000ug | 2525 € | MBS Recombinant Proteins | human |
| AE17705SH | Sheep Sorbitol dehydrogenase (SORD) ELISA Kit | 96 wells plate | 810 € | ab-elisa elisas | sheep |
| AE17705SH-96 | Sheep Sorbitol dehydrogenase (SORD) ELISA Kit | 1x plate of 96 wells | 671 € | abebio | sheep |
| GENTAUR-58b81a584b81c | Sorbitol-6-phosphate 2-dehydrogenase (sorD) | 100ug | 1785 € | MBS Recombinant Proteins | human |
| GENTAUR-58b81a589b89d | Sorbitol-6-phosphate 2-dehydrogenase (sorD) | 1000ug | 1785 € | MBS Recombinant Proteins | human |
| GENTAUR-58b81a590d66b | Sorbitol-6-phosphate 2-dehydrogenase (sorD) | 100ug | 2299 € | MBS Recombinant Proteins | human |
| GENTAUR-58b81a595980f | Sorbitol-6-phosphate 2-dehydrogenase (sorD) | 1000ug | 2299 € | MBS Recombinant Proteins | human |
| GENTAUR-58b82b62d49b7 | Sorbitol-6-phosphate 2-dehydrogenase (sorD) | 100ug | 1785 € | MBS Recombinant Proteins | human |
| GENTAUR-58b82b634e651 | Sorbitol-6-phosphate 2-dehydrogenase (sorD) | 1000ug | 1785 € | MBS Recombinant Proteins | human |
| GENTAUR-58b82b63be262 | Sorbitol-6-phosphate 2-dehydrogenase (sorD) | 100ug | 2299 € | MBS Recombinant Proteins | human |
| GENTAUR-58b82b644e669 | Sorbitol-6-phosphate 2-dehydrogenase (sorD) | 1000ug | 2299 € | MBS Recombinant Proteins | human |
| GENTAUR-58b843d9e74d5 | Sorbitol-6-phosphate 2-dehydrogenase (sorD) | 100ug | 1785 € | MBS Recombinant Proteins | human |
| GENTAUR-58b843da3e314 | Sorbitol-6-phosphate 2-dehydrogenase (sorD) | 1000ug | 1785 € | MBS Recombinant Proteins | human |
| GENTAUR-58b843da8e422 | Sorbitol-6-phosphate 2-dehydrogenase (sorD) | 100ug | 2299 € | MBS Recombinant Proteins | human |
| GENTAUR-58b843dae2a9f | Sorbitol-6-phosphate 2-dehydrogenase (sorD) | 1000ug | 2299 € | MBS Recombinant Proteins | human |
| abx166326 | Anti-Sorbitol Dehydrogenase Protein (Recombinant) | 10 μg | 427 € | abbex | human |
| abx167610 | Anti-Sorbitol Dehydrogenase Protein (Recombinant) | 100 μg | 862 € | abbex | human |
| abx168128 | Anti-Sorbitol Dehydrogenase Protein (Recombinant) | 100 μg | 833 € | abbex | human |
| GWB-P1464H | SORD, 1-357aa, Recombinant Protein | bulk | Ask price € | genways bulk | human |
| abx250981 | Anti-Human Sorbitol dehydrogenase ELISA Kit | inquire | 50 € | abbex | human |
| abx575216 | Anti-Human Sorbitol Dehydrogenase (SDH) ELISA Kit | inquire | 50 € | abbex | human |