Recombinant Human Sorbitol Dehydrogenase, SORD (C-6His)

Catalog number:	C885 Buy Now
Price:	50 €
Supplier:	abbex
Product name:	Recombinant Human Sorbitol Dehydrogenase, SORD (C-6His)
Quantity:	inquire
Other quantities:	1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:	human recombinant sapiens chis fraq reacts

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Sorbitol Dehydrogenase is produced by our Mammalian expression system and the target gene encoding Ala2-Pro357 is expressed with a 6His tag at the C-terminus
Molecular Weight:	3 kD, 39
UniProt number:	Q00796
State of the product:	Liquid
Shipping conditions:	Dry ice/ice packs
Formulation:	2 um filtered solution of 20 mM TrisHCl, 20% glycerol, 2M sodium chloride, 5 mM DTT, Supplied as a 0, pH8
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNPVDHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	SORD (C-6His), Sorbitol Dehydrogenase
Short name:	SORD (C-6His), Recombinant Sorbitol Dehydrogenase
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	SORD (C-6His), sapiens Sorbitol Dehydrogenase, recombinant H
Alternative technique:	rec
Identity:	3829
Gene:	FRA10A | More about : FRA10A
Long gene name:	folic acid type, fra(10)(q23, fragile site, rare, 2) , 3) or fra(10)(q24
Locus:	10q23, 2 , 3 or 10q24
Discovery year:	1986-01-01
Pubmed identfication:	15203205

• #human
• #recombinant
• #sapiens
• #chis
• #fraq
• #reacts