Recombinant Human Sorbitol Dehydrogenase, SORD (C-6His)

Contact us
Catalog number: C885
Price: 50 €
Supplier: abbex
Product name: Recombinant Human Sorbitol Dehydrogenase, SORD (C-6His)
Quantity: inquire
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Sorbitol Dehydrogenase is produced by our Mammalian expression system and the target gene encoding Ala2-Pro357 is expressed with a 6His tag at the C-terminus
Molecular Weight: 3 kD, 39
UniProt number: Q00796
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 2 um filtered solution of 20 mM TrisHCl, 20% glycerol, 2M sodium chloride, 5 mM DTT, Supplied as a 0, pH8
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SORD (C-6His), Sorbitol Dehydrogenase
Short name: SORD (C-6His), Recombinant Sorbitol Dehydrogenase
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: SORD (C-6His), sapiens Sorbitol Dehydrogenase, recombinant H
Alternative technique: rec
Identity: 3829
Gene: FRA10A | More about : FRA10A
Long gene name: folic acid type, fra(10)(q23, fragile site, rare, 2) , 3) or fra(10)(q24
Locus: 10q23, 2 , 3 or 10q24
Discovery year: 1986-01-01
Pubmed identfication: 15203205

Related Products :

C885 Recombinant Human Sorbitol Dehydrogenase, SORD (C-6His) 50 µg 496 € novo human
AE17705SH-48 ELISA test for Sheep Sorbitol dehydrogenase (SORD) 1x plate of 48 wells 402 € abebio sheep
GENTAUR-58bda42d4edeb Macaca fascicularis Sorbitol dehydrogenase (SORD) 100ug 2011 € MBS Recombinant Proteins human
GENTAUR-58bda42dbbfa8 Macaca fascicularis Sorbitol dehydrogenase (SORD) 1000ug 2011 € MBS Recombinant Proteins human
GENTAUR-58bda42e45b5d Macaca fascicularis Sorbitol dehydrogenase (SORD) 100ug 2525 € MBS Recombinant Proteins human
GENTAUR-58bda42ea3fcd Macaca fascicularis Sorbitol dehydrogenase (SORD) 1000ug 2525 € MBS Recombinant Proteins human
GENTAUR-58bda4ce17de8 Macaca fascicularis Sorbitol dehydrogenase (SORD) 100ug 2011 € MBS Recombinant Proteins human
GENTAUR-58bda4ce48df5 Macaca fascicularis Sorbitol dehydrogenase (SORD) 1000ug 2011 € MBS Recombinant Proteins human
GENTAUR-58bda4ce7dd52 Macaca fascicularis Sorbitol dehydrogenase (SORD) 100ug 2525 € MBS Recombinant Proteins human
GENTAUR-58bda4cf0c5f3 Macaca fascicularis Sorbitol dehydrogenase (SORD) 1000ug 2525 € MBS Recombinant Proteins human
AE17705SH Sheep Sorbitol dehydrogenase (SORD) ELISA Kit 96 wells plate 810 € ab-elisa elisas sheep
AE17705SH-96 Sheep Sorbitol dehydrogenase (SORD) ELISA Kit 1x plate of 96 wells 671 € abebio sheep
GENTAUR-58b81a584b81c Sorbitol-6-phosphate 2-dehydrogenase (sorD) 100ug 1785 € MBS Recombinant Proteins human
GENTAUR-58b81a589b89d Sorbitol-6-phosphate 2-dehydrogenase (sorD) 1000ug 1785 € MBS Recombinant Proteins human
GENTAUR-58b81a590d66b Sorbitol-6-phosphate 2-dehydrogenase (sorD) 100ug 2299 € MBS Recombinant Proteins human
GENTAUR-58b81a595980f Sorbitol-6-phosphate 2-dehydrogenase (sorD) 1000ug 2299 € MBS Recombinant Proteins human
GENTAUR-58b82b62d49b7 Sorbitol-6-phosphate 2-dehydrogenase (sorD) 100ug 1785 € MBS Recombinant Proteins human
GENTAUR-58b82b634e651 Sorbitol-6-phosphate 2-dehydrogenase (sorD) 1000ug 1785 € MBS Recombinant Proteins human
GENTAUR-58b82b63be262 Sorbitol-6-phosphate 2-dehydrogenase (sorD) 100ug 2299 € MBS Recombinant Proteins human
GENTAUR-58b82b644e669 Sorbitol-6-phosphate 2-dehydrogenase (sorD) 1000ug 2299 € MBS Recombinant Proteins human
GENTAUR-58b843d9e74d5 Sorbitol-6-phosphate 2-dehydrogenase (sorD) 100ug 1785 € MBS Recombinant Proteins human
GENTAUR-58b843da3e314 Sorbitol-6-phosphate 2-dehydrogenase (sorD) 1000ug 1785 € MBS Recombinant Proteins human
GENTAUR-58b843da8e422 Sorbitol-6-phosphate 2-dehydrogenase (sorD) 100ug 2299 € MBS Recombinant Proteins human
GENTAUR-58b843dae2a9f Sorbitol-6-phosphate 2-dehydrogenase (sorD) 1000ug 2299 € MBS Recombinant Proteins human
abx166326 Anti-Sorbitol Dehydrogenase Protein (Recombinant) 10 μg 427 € abbex human
abx167610 Anti-Sorbitol Dehydrogenase Protein (Recombinant) 100 μg 862 € abbex human
abx168128 Anti-Sorbitol Dehydrogenase Protein (Recombinant) 100 μg 833 € abbex human
GWB-P1464H SORD, 1-357aa, Recombinant Protein bulk Ask price € genways bulk human
abx250981 Anti-Human Sorbitol dehydrogenase ELISA Kit inquire 50 € abbex human
abx575216 Anti-Human Sorbitol Dehydrogenase (SDH) ELISA Kit inquire 50 € abbex human