Recombinant Human VIP36, LMAN2, GP36b (C-6His)

Contact us
Catalog number: C845
Price: 496 €
Supplier: novo
Product name: Recombinant Human VIP36, LMAN2, GP36b (C-6His)
Quantity: 50 µg
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Vesicular Integral-Membrane Protein VIP36 is produced by our Mammalian expression system and the target gene encoding Asp45-Arg322 is expressed with a 6His tag at the C-terminus
Molecular Weight: 32, 7 kD
UniProt number: Q12907
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 10 mM GSH, 2 um filtered solution of 50 mM TrisHCl, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GP36b (C-6His), LMAN2, VIP36
Short name: GP36b (C-6His), LMAN2, Recombinant VIP36
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: GP36b (C-6His), LMAN2, sapiens VIP36, recombinant H
Alternative technique: rec
Identity: 16986
Gene: LMAN2 | More about : LMAN2
Long gene name: lectin, mannose binding 2
Synonyms gene: C5orf8
Synonyms gene name: chromosome 5 open reading frame 8 lectin, mannose-binding 2
Synonyms: GP36B VIP36
Locus: 5q35, 3
Discovery year: 2001-10-18
GenBank acession: U10362
Entrez gene record: 10960
Pubmed identfication: 12609988
RefSeq identity: NM_006816
Havana BLAST/BLAT: OTTHUMG00000130860

Related Products :

C845 Recombinant Human VIP36, LMAN2, GP36b (C-6His) 50 µg 369 € novo human
RP-1669H Recombinant Human LMAN2 / VIP36 Protein (His Tag) 20μg 572 € adv human
CI79 Recombinant Human VIP36-Like Protein, LMAN2L (C-6His) 1 mg 2283 € novo human
abx253905 Anti-Human Vesicular integral-membrane protein VIP36 ELISA Kit 96 tests 659 € abbex human
abx570945 Anti-Human Lectin, Mannose Binding 2 (LMAN2) ELISA Kit inquire 50 € abbex human
abx152212 Anti-Human LMAN2 ELISA Kit inquire 50 € abbex human
DL-LMAN2-Hu Human Lectin, Mannose Binding 2 LMAN2 ELISA Kit 96T 904 € DL elisas human
LV206369 LMAN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV206370 LMAN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV206371 LMAN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV206372 LMAN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV206374 LMAN2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV206373 LMAN2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bded6a14e3b Anti- LMAN2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bded6ace777 Anti- LMAN2 Antibody 0.12 ml 348 € MBS Polyclonals human
AP52503PU-N anti-LMAN2 (C-term) Antibody 0,4 ml 587 € acr human
abx922662 Anti-LMAN2 siRNA 30 nmol 717 € abbex human
abx922663 Anti-LMAN2 siRNA 30 nmol 717 € abbex human
EKU05580 Lectin, Mannose Binding 2 (LMAN2) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
GWB-MQ560B LMAN2 antibody 1 vial 521 € genways human
GWB-MQ561C LMAN2 antibody 1 vial 521 € genways human
GWB-EDD881 LMAN2 Over-expression Lysate reagent 1 vial 463 € genways human
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
CC79 Recombinant Human GM-CSF, CSF2 (C-6His, Human Cells) 10 µg 146 € novo human
CD98 Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, Human Cells) 500 µg 1613 € novo human
CB01 Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells) 500 µg 1613 € novo human
C848 Recombinant Human 15-PGDH, HPGD (C-6His) 500 µg 1613 € novo human
CI63 Recombinant Human 17β-Hydroxysteroid Dehydrogenase 10, HSD17B10 (C-6His) 1 mg 2486 € novo human
CH76 Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein, OASLOASL (C-6His) 10 µg 202 € novo human
CE05 Recombinant Human 3-Hydroxybutyrate Dehydrogenase Type 2, BDH2, DHRS6 (N-6His) 50 µg 496 € novo human