Recombinant Human VAMPB, VAPB (C-6His)

Catalog number:	C778 Buy Now
Price:	2172 €
Supplier:	MBS Recombinant Proteins
Product name:	Recombinant Human VAMPB, VAPB (C-6His)
Quantity:	100ug
Other quantities:	50 µg 303€ 500 µg 1613€
Related search:	human vapb sapiens chis alternative

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human VAMPB is produced by our E, coli expression system and the target gene encoding Ala2-Pro132 is expressed with a 6His tag at the C-terminus
Molecular Weight:	16 kD
UniProt number:	O95292
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPLEHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	VAPB (C-6His), VAMPB
Short name:	VAPB (C-6His), Recombinant VAMPB
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	VAPB (C-6His), sapiens VAMPB, recombinant H
Alternative technique:	rec
Identity:	12649
Gene:	VAPB | More about : VAPB
Long gene name:	VAMP associated protein B and C
Synonyms gene name:	VAMP (vesicle-associated membrane protein)-associated protein B and C
Synonyms:	VAP-B VAP-C ALS8
Locus:	20q13, 32
Discovery year:	1999-03-19
GenBank acession:	AF086628
Entrez gene record:	9217
Pubmed identfication:	9920726
Havana BLAST/BLAT:	OTTHUMG00000032840
Locus Specific Databases:	ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database LRG_656

• #human
• #vapb
• #sapiens
• #chis
• #alternative