Recombinant Human VAMPB, VAPB (C-6His)

Contact us
Catalog number: C778
Price: 2172 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human VAMPB, VAPB (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human VAMPB is produced by our E, coli expression system and the target gene encoding Ala2-Pro132 is expressed with a 6His tag at the C-terminus
Molecular Weight: 16 kD
UniProt number: O95292
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: VAPB (C-6His), VAMPB
Short name: VAPB (C-6His), Recombinant VAMPB
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: VAPB (C-6His), sapiens VAMPB, recombinant H
Alternative technique: rec
Identity: 12649
Gene: VAPB | More about : VAPB
Long gene name: VAMP associated protein B and C
Synonyms gene name: VAMP (vesicle-associated membrane protein)-associated protein B and C
Synonyms: VAP-B VAP-C ALS8
Locus: 20q13, 32
Discovery year: 1999-03-19
GenBank acession: AF086628
Entrez gene record: 9217
Pubmed identfication: 9920726
Havana BLAST/BLAT: OTTHUMG00000032840
Locus Specific Databases: ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database LRG_656

Related Products :

C778 Recombinant Human VAMPB, VAPB (C-6His) 1 mg 2283 € novo human
GENTAUR-58b8c1a348324 Antitoxin VapB (vapB) 100ug 1304 € MBS Recombinant Proteins human
GENTAUR-58b8c1a39eb20 Antitoxin VapB (vapB) 1000ug 1304 € MBS Recombinant Proteins human
GENTAUR-58b8c1a421e78 Antitoxin VapB (vapB) 100ug 1807 € MBS Recombinant Proteins human
GENTAUR-58b8c1a47681e Antitoxin VapB (vapB) 1000ug 1807 € MBS Recombinant Proteins human
GENTAUR-58b9c2292c50f Antitoxin VapB (vapB) 100ug 1304 € MBS Recombinant Proteins human
GENTAUR-58b9c229a2b3e Antitoxin VapB (vapB) 1000ug 1304 € MBS Recombinant Proteins human
GENTAUR-58b9c229e78ee Antitoxin VapB (vapB) 100ug 1807 € MBS Recombinant Proteins human
GENTAUR-58b9c22a8473a Antitoxin VapB (vapB) 1000ug 1807 € MBS Recombinant Proteins human
GWB-P1238C VAPB, 1-222aa, Recombinant Protein bulk Ask price € genways bulk human
GENTAUR-58bd0b821ee63 Human Vesicle-associated membrane protein-associated protein B/C (VAPB) 100ug 1669 € MBS Recombinant Proteins human
GENTAUR-58bd0b8262fab Human Vesicle-associated membrane protein-associated protein B/C (VAPB) 1000ug 1669 € MBS Recombinant Proteins human
GENTAUR-58bd0b82bdf73 Human Vesicle-associated membrane protein-associated protein B/C (VAPB) 100ug 2183 € MBS Recombinant Proteins human
GENTAUR-58bd0b8318862 Human Vesicle-associated membrane protein-associated protein B/C (VAPB) 1000ug 2183 € MBS Recombinant Proteins human
GWB-BSP709 VAPB Human Protein bulk Ask price € genways bulk human
AR09740PU-L anti-VAMP-associated protein B/C (VAPB) (1-222, His-tag) Antibody 0,5 mg 1138 € acr human
AR09740PU-N anti-VAMP-associated protein B/C (VAPB) (1-222, His-tag) Antibody 0,1 mg 485 € acr human
GENTAUR-58be0b264741d Anti- VAPB Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0b26b7fa7 Anti- VAPB Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be3c0fcd361 Anti- VAPB Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be5506d09db Anti- VAPB Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be55073dba6 Anti- VAPB Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be55079d807 Anti- VAPB Antibody 50ug 304 € MBS Polyclonals human
abx148161 Anti-VAPB Antibody inquire 50 € abbex human
GENTAUR-58be628edcdf2 Anti-VAPB (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx939330 Anti-VAPB siRNA inquire 50 € abbex human
abx939331 Anti-VAPB siRNA 30 nmol 717 € abbex human
GENTAUR-58b9a39037ef6 Pig Vesicle-associated membrane protein-associated protein B (VAPB) 100ug 1658 € MBS Recombinant Proteins pig
GENTAUR-58b9a39074d0c Pig Vesicle-associated membrane protein-associated protein B (VAPB) 1000ug 1658 € MBS Recombinant Proteins pig
GENTAUR-58b9a390eb521 Pig Vesicle-associated membrane protein-associated protein B (VAPB) 100ug 2172 € MBS Recombinant Proteins pig