| Catalog number: | C778 |
|---|---|
| Price: | 2172 € |
| Supplier: | MBS Recombinant Proteins |
| Product name: | Recombinant Human VAMPB, VAPB (C-6His) |
| Quantity: | 100ug |
| Other quantities: | 1 mg 2283€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human VAMPB is produced by our E, coli expression system and the target gene encoding Ala2-Pro132 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 16 kD |
| UniProt number: | O95292 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPLEHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | VAPB (C-6His), VAMPB |
| Short name: | VAPB (C-6His), Recombinant VAMPB |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | VAPB (C-6His), sapiens VAMPB, recombinant H |
| Alternative technique: | rec |
| Identity: | 12649 |
| Gene: | VAPB | More about : VAPB |
| Long gene name: | VAMP associated protein B and C |
| Synonyms gene name: | VAMP (vesicle-associated membrane protein)-associated protein B and C |
| Synonyms: | VAP-B VAP-C ALS8 |
| Locus: | 20q13, 32 |
| Discovery year: | 1999-03-19 |
| GenBank acession: | AF086628 |
| Entrez gene record: | 9217 |
| Pubmed identfication: | 9920726 |
| Havana BLAST/BLAT: | OTTHUMG00000032840 |
| Locus Specific Databases: | ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database LRG_656 |
| C778 | Recombinant Human VAMPB, VAPB (C-6His) | 1 mg | 2283 € | novo | human |
| GENTAUR-58b8c1a348324 | Antitoxin VapB (vapB) | 100ug | 1304 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8c1a39eb20 | Antitoxin VapB (vapB) | 1000ug | 1304 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8c1a421e78 | Antitoxin VapB (vapB) | 100ug | 1807 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8c1a47681e | Antitoxin VapB (vapB) | 1000ug | 1807 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c2292c50f | Antitoxin VapB (vapB) | 100ug | 1304 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c229a2b3e | Antitoxin VapB (vapB) | 1000ug | 1304 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c229e78ee | Antitoxin VapB (vapB) | 100ug | 1807 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c22a8473a | Antitoxin VapB (vapB) | 1000ug | 1807 € | MBS Recombinant Proteins | human |
| GWB-P1238C | VAPB, 1-222aa, Recombinant Protein | bulk | Ask price € | genways bulk | human |
| GENTAUR-58bd0b821ee63 | Human Vesicle-associated membrane protein-associated protein B/C (VAPB) | 100ug | 1669 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd0b8262fab | Human Vesicle-associated membrane protein-associated protein B/C (VAPB) | 1000ug | 1669 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd0b82bdf73 | Human Vesicle-associated membrane protein-associated protein B/C (VAPB) | 100ug | 2183 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd0b8318862 | Human Vesicle-associated membrane protein-associated protein B/C (VAPB) | 1000ug | 2183 € | MBS Recombinant Proteins | human |
| GWB-BSP709 | VAPB Human Protein | bulk | Ask price € | genways bulk | human |
| AR09740PU-L | anti-VAMP-associated protein B/C (VAPB) (1-222, His-tag) Antibody | 0,5 mg | 1138 € | acr | human |
| AR09740PU-N | anti-VAMP-associated protein B/C (VAPB) (1-222, His-tag) Antibody | 0,1 mg | 485 € | acr | human |
| GENTAUR-58be0b264741d | Anti- VAPB Antibody | 0.06 ml | 265 € | MBS Polyclonals | human |
| GENTAUR-58be0b26b7fa7 | Anti- VAPB Antibody | 0.12 ml | 348 € | MBS Polyclonals | human |
| GENTAUR-58be3c0fcd361 | Anti- VAPB Antibody | 100ug | 393 € | MBS Polyclonals | human |
| GENTAUR-58be5506d09db | Anti- VAPB Antibody | 100ug | 387 € | MBS Polyclonals | human |
| GENTAUR-58be55073dba6 | Anti- VAPB Antibody | 0.2 mg | 558 € | MBS Polyclonals | human |
| GENTAUR-58be55079d807 | Anti- VAPB Antibody | 50ug | 304 € | MBS Polyclonals | human |
| abx148161 | Anti-VAPB Antibody | inquire | 50 € | abbex | human |
| GENTAUR-58be628edcdf2 | Anti-VAPB (Polyclonal), ALEXA Fluor 594 | 100 microliters | 489 € | Bioss Polyclonal Antibodies | human |
| abx939330 | Anti-VAPB siRNA | inquire | 50 € | abbex | human |
| abx939331 | Anti-VAPB siRNA | 30 nmol | 717 € | abbex | human |
| GENTAUR-58b9a39037ef6 | Pig Vesicle-associated membrane protein-associated protein B (VAPB) | 100ug | 1658 € | MBS Recombinant Proteins | pig |
| GENTAUR-58b9a39074d0c | Pig Vesicle-associated membrane protein-associated protein B (VAPB) | 1000ug | 1658 € | MBS Recombinant Proteins | pig |
| GENTAUR-58b9a390eb521 | Pig Vesicle-associated membrane protein-associated protein B (VAPB) | 100ug | 2172 € | MBS Recombinant Proteins | pig |