| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Not all receptor antagonist that bind to enzymes are inhibitors, Since blocking an enzyme's activity can kill a pathogen , activator, caspase, esterase inhibitors , lipoprotein, many drugs are enzyme inhibitors, papain, pathway, peptidase, protease , proteinase, trypsin, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme, , Tissue, acrosin, activity, and decreases its , are , bind to enzymes and increase their , enzymatic activity, enzyme activator ligands or agonists , enzyme receptor , imbalance, metabolic , or correct a , or receptor ligands or receptor antagonists that bind to an , proteins |
| Molecular Weight: |
45, 6 kD |
| UniProt number: |
Q91WP6 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0, pH8 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPKHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
Serpin A3N (C-6His), Serine Protease Inhibitor A3N |
| Short name: |
Serpin A3N (C-6His), Recombinant Mouse Serine Protease Inhibitor A3N |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
Serpin A3N (C-6His), recombinant Mouse Serine Protease suppressor A3N |
| Alternative technique: |
rec |