Recombinant Human MHC Class I Polypeptide-Related Sequence A, MICA (C-6His)

Contact us
Catalog number: C489
Price: Ask price €
Supplier: genways bulk
Product name: Recombinant Human MHC Class I Polypeptide-Related Sequence A, MICA (C-6His)
Quantity: bulk
Other quantities: 1 mg 1826€ 50 µg 273€ 500 µg 1293€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human MHC Class I-related Protein A is produced by our Mammalian expression system and the target gene encoding Glu24-Gln308 is expressed with a 6His tag at the C-terminus
Molecular Weight: 33, 87 kD
UniProt number: Q29983
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MICA (C-6His), MHC Class I Polypeptide-Related A
Short name: MICA (C-6His), Recombinant MHC Class I Polypeptide- Sequence A
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Major histocompabitility complex class I polypeptide-related sequence A (C-6His), sapiens Major histocompabitility complex Class I multipeptide-Related Sequence A, recombinant H
Alternative technique: rec
Alternative to gene target: MICA and IDBG-77578 and ENSG00000204520 and 100507436, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0006955 and immune response and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019882 and antigen processing and presentation and biological process this GO :0045087 and innate immune response and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, MHC class I polypeptide-related sequence A
Identity: 7090
Gene: MICA | More about : MICA
Long gene name: MHC class I polypeptide-related sequence A
Synonyms: PERB11, 1
Locus: 6p21, 33
Discovery year: 1994-05-16
GenBank acession: L14848
Entrez gene record: 100507436
Pubmed identfication: 8022771
RefSeq identity: NM_001177519
Classification: C1-set domain containing
Havana BLAST/BLAT: OTTHUMG00000031073
Locus Specific Databases: IMGT/HLA Database

Related Products :

MBS621324 MHC Class 1 Chain-related Gene A (MHC Class I Polypeptide-related Sequence A, MICA, MIC-A, PERB11.1) Antibody 100ug 558 € MBS Polyclonals_1 human
C489 Recombinant Human MHC Class I Polypeptide-Related Sequence A, MICA (C-6His) 10 µg 121 € novo human
CG11 Recombinant Human MHC Class I Polypeptide-Related Sequence A, MICA (C-Fc) 500 µg 1613 € novo human
GWB-5D823B Mhc Class I-related protein (MICA) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 tube 602 € genways human
abx250154 Anti-Human MHC class I polypeptide-related sequence A ELISA Kit inquire 50 € abbex human
FMAS053p Mouse MHC Class I & II, H-2/I-A, HLA-DR (MHC Class II), Clone: YE2/36 HLK, Rat Mouse Monoclonal antibody-Hu, FITC; frozen/paraffin, IH/ELISA/flow 1000ul Ask price € accurate-monoclonals mouse
MBS619916 CIITA, CT (Class II Major Histocompatibility Complex Transactivator, Class II Trans Activator, C2TA, CIITA IV, MHC2TA, MHC Class II Transactivator, NLRA) Antibody 50ug 906 € MBS Polyclonals_1 human
RP-825 Recombinant (E.Coli, His-tag) Human MHC class I chain-related gene B 10 μg 333 € adi human
RP-824 Recombinant (E.Coli) Human MHC class I chain-related gene A 10 μg 333 € adi human
abx262125 Anti-MHC class I chain-related gene A Protein (Recombinant) 1 mg 5328 € abbex human
abx262126 Anti-MHC class I chain-related gene B Protein (Recombinant) 1 mg 5328 € abbex human
MBS621291 Bcl 2-Related Protein A1 (Bcl 2 Related Protein A1, Bcl-2-related Protein A1, ACC-1, ACC-2, BCL2L5, BFL1, BFL-1, GRS, Hematopoietic Bcl2-related Protein A1, HBPA1, Hemopoietic-specific Early Response Protein, Protein BFL-1, Protein GRS) Antibody 50ug 724 € MBS Polyclonals_1 human
CI10 Recombinant Human Pancreatic Polypeptide, PPY (C-6His) 10 µg 202 € novo human
CI50 Recombinant Human Polypeptide GalNac Transferase 3, GALNT3 (C-6His) 1 mg 2486 € novo human
MAS053b HLA-DR (MHC Class II), Monomorphic,Mouse Class I/II, H-2/I-A,Clone: YE2/36 HLK,Rat Mouse Monoclonal antibody-Hu;frozen/paraffin,IH/ELISA/flow 5 ml Ask price € accurate-monoclonals mouse
MAS053c HLA-DR (MHC Class II), Monomorphic,Mouse Class I/II, H-2/I-A,Clone: YE2/36 HLK,Rat Mouse Monoclonal antibody-Hu;frozen/paraffin,IH/ELISA/flow 1000ul Ask price € accurate-monoclonals mouse
MAS053p HLA-DR (MHC Class II), Monomorphic,Mouse Class I/II, H-2/I-A,Clone: YE2/36 HLK,Rat Mouse Monoclonal antibody-Hu;frozen/paraffin,IH/ELISA/flow 0.5 mg Ask price € accurate-monoclonals mouse
OBT0020 HLA-DR (MHC Class II), Monomorphic,Mouse Class I/II, H-2/I-A,Clone: YE2/36 HLK,Rat Mouse Monoclonal antibody-Hu;frozen/paraffin,IH/ELISA/flow 5 ml Ask price € accurate-monoclonals mouse
GENTAUR-58be31be76af0 MHC Class 1, H2, KK (H-2 Class I Histocompatibility Antigen, K-K alpha Chain, H-2K(K), H2-K1, H2-K) (Biotin) 500ug 542 € MBS mono human
GENTAUR-58be31be2206b MHC Class 1, H2, KK (H-2 Class I Histocompatibility Antigen, K-K alpha Chain, H-2K(K), H2-K1, H2-K) (Biotin) Antibody 500ug 542 € MBS mono human
YV0181-01 SLA Class I (Swine MHC Class I), Clone: 74-11-10, Mouse Monoclonal antibody-Swine 0.1 mg 354 € accurate-monoclonals mouse
YV0181-05 SLA Class I (Swine MHC Class I), Clone: 74-11-10, Mouse Monoclonal antibody-Swine 0.5 mg Ask price € accurate-monoclonals mouse
MBS615690 PACAP-Related Peptide (Pituitary Adenylate Cyclase Activating Polypeptide Related Peptide) 0.05 ml 851 € MBS Polyclonals_1 human
ODN-PK-5 TLR9-B class agonist kit, Contains 100 ug of - ODN1668-1; ODN1826;and ODN2006 - ODN BW006 - B class, human/mouse - ODN 2007 - B-class, bovine/porcine - ODN D-SL01 1 pk 550 € adi human
C882 Recombinant Human Alcohol Dehydrogenase Class 4 Mu, ADH7 (C-6His) 10 µg 202 € novo human
101-M569 Anti-Human MICA 100ug 336 € Reliatech antibodies human
BB-EK0812 anti-Human MICA ELISA Kit Antibody 96 Tests 761 € acr human
CEK1268 anti-Human MICA ELISA Kit Antibody 96 Tests 703 € acr human
GWB-5R6XL4 Human MICA 96 well plate ELISA assay Kit 1 tube 775 € genways human
GWB-F774F4 MICA Human bulk Ask price € genways bulk human