| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human MHC Class I-related Protein A is produced by our Mammalian expression system and the target gene encoding Glu24-Gln308 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
33, 87 kD |
| UniProt number: |
Q29983 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
MICA (C-6His), MHC Class I Polypeptide-Related A |
| Short name: |
MICA (C-6His), Recombinant MHC Class I Polypeptide- Sequence A |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Major histocompabitility complex class I polypeptide-related sequence A (C-6His), sapiens Major histocompabitility complex Class I multipeptide-Related Sequence A, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
MICA and IDBG-77578 and ENSG00000204520 and 100507436, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0006955 and immune response and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019882 and antigen processing and presentation and biological process this GO :0045087 and innate immune response and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, MHC class I polypeptide-related sequence A |
| Identity: |
7090 |
| Gene: |
MICA |
More about : MICA |
| Long gene name: |
MHC class I polypeptide-related sequence A |
| Synonyms: |
PERB11, 1 |
| Locus: |
6p21, 33 |
| Discovery year: |
1994-05-16 |
| GenBank acession: |
L14848 |
| Entrez gene record: |
100507436 |
| Pubmed identfication: |
8022771 |
| RefSeq identity: |
NM_001177519 |
| Classification: |
C1-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000031073 |
| Locus Specific Databases: |
IMGT/HLA Database |