| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Inducible Co-Stimulator Ligand is produced by our Mammalian expression system and the target gene encoding Asp19-Ser258 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
27, 72 kD |
| UniProt number: |
O75144 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD275 (C-6His), ICOSLG, B7-H2 |
| Short name: |
CD275 (C-6His), ICOSLG, Recombinant B7-H2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD275 (C-6His), inducible T-cellular co-stimulator ligand, sapiens B7-H2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ICOSLG and IDBG-5107 and ENSG00000160223 and 102723996, ICOSLG and IDBG-639662 and ENSBTAG00000014880 and 507857, Icosl and IDBG-168471 and ENSMUSG00000000732 and 50723, Plasma membranes, protein binding, this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006952 and defense response and biological process this GO :0006972 and hyperosmotic response and biological process this GO :0007165 and signal transduction and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0031295 and T cell costimulation and biological process this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0042110 and T cell activation and biological process this GO :0042113 and B cell activation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, 23308, inducible T-cell co-stimulator ligand |
| Identity: |
17087 |
| Gene: |
ICOSLG |
More about : ICOSLG |
| Long gene name: |
inducible T-cell costimulator ligand |
| Synonyms gene: |
ICOSL |
| Synonyms: |
KIAA0653 GL50 B7-H2 B7RP-1 B7H2 B7RP1 ICOS-L CD275 |
| Synonyms name: |
B7-related protein 1 B7 homologue 2 B7 homolog 2 |
| Locus: |
21q22, 3 |
| Discovery year: |
2003-12-12 |
| GenBank acession: |
AB014553 |
| Entrez gene record: |
23308 |
| Pubmed identfication: |
9734811 11007762 |
| RefSeq identity: |
NM_015259 |
| Classification: |
Endogenous ligands C2-set domain containing CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000086920 |