Recombinant Human CD99, MIC2 (C-6His)

Contact us
Catalog number: C447
Price: 347 €
Supplier: acr
Product name: Recombinant Human CD99, MIC2 (C-6His)
Quantity: 50 Вµg
Other quantities: 10 µg 131€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CD99 is produced by our Mammalian expression system and the target gene encoding Asp23-Asp122 is expressed with a 6His tag at the C-terminus
Molecular Weight: 11, 13 kD
UniProt number: P14209
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MIC2 (C-6His), CD99
Short name: MIC2 (C-6His), Recombinant CD99
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: MIC2 (C-6His), sapiens CD99 molecule, recombinant H
Alternative technique: rec
Alternative to gene target: CD99 and IDBG-40790 and ENSG00000002586 and 4267, CD99 and IDBG-639094 and ENSBTAG00000008114 and, HBA71 and MIC2 and MIC2X and MIC2Y and MSK5X, Plasma membranes, this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process, CD99 molecule
Identity: 7082
Gene: CD99 | More about : CD99
Long gene name: CD99 molecule
Synonyms gene: MIC2
Synonyms gene name: F21 and O13 CD99 antigen , antigen identified by monoclonal antibodies 12E7
Locus: Xp22, 3 , 32 and Yp11
Discovery year: 2001-06-22
GenBank acession: M16279
Entrez gene record: 4267
RefSeq identity: NM_001122898
Classification: CD molecules Pseudoautosomal region 1
Havana BLAST/BLAT: OTTHUMG00000021073
Locus Specific Databases: Mental Retardation database LRG_1023

Related Products :

C447 Recombinant Human CD99, MIC2 (C-6His) 1 mg 2283 € novo human
CD09 Recombinant Human CD99, MIC2 (C-Fc) 500 µg 1613 € novo human
MBS300553 Anti-Human CD99/MIC2 (Ewing's Sarcoma Marker) PAb 7 ml (RTU) 288 € MBS Polyclonals_1 human
MBS300554 Anti-Human CD99/MIC2 (Ewing's Sarcoma Marker) PAb 1 mililiter 459 € MBS Polyclonals_1 human
MBS301120 Anti-Human CD99/MIC2 (Ewing's Sarcoma Marker) PAb 100ul 216 € MBS Polyclonals_1 human
MBS302154 Anti-Human CD99/MIC2 (Ewing's Sarcoma Marker) PAb 500ul 332 € MBS Polyclonals_1 human
MEDCLA253-01 CD99, MIC2 Antigen, E2 Adhesion Molecule, 32kD, Clone: HO36-1.1, Mouse Monoclonal antibody-Human; frozen/paraffin, IH 0.1000ul 428 € accurate-monoclonals human
MEDCLA253-1 CD99, MIC2 Antigen, E2 Adhesion Molecule, 32kD, Clone: HO36-1.1, Mouse Monoclonal antibody-Human; frozen/paraffin, IH 1000ul 1502 € accurate-monoclonals human
YM1158 CD99, MIC2 Antigen, E2 Adhesion Molecule, Clone: MEM-131, Mouse Monoclonal antibody-Human 1000ul 1428 € accurate-monoclonals human
YM2015 CD99, MIC2, Clone: H036-1.1, Mouse Monoclonal antibody-Human; flow/WB 0.1mg 534 € accurate-monoclonals human
BMDV3038 CD99, MIC2 Gene Product, Clone: 12E7, Mouse Monoclonal antibody-Human; frozen/NO paraffin 500ul 1281 € accurate-monoclonals human
AM08352PU-N anti-CD99 / MIC2 Antibody 50 Вµg 732 € acr human
AM20582PU-M anti-CD99 / MIC2 Antibody 0,5 ml 790 € acr human
AM20582PU-N anti-CD99 / MIC2 Antibody 1 ml 1109 € acr human
AM20582PU-S anti-CD99 / MIC2 Antibody 0,1 ml 471 € acr human
AM26145AC-N anti-CD99 / MIC2 Antibody 100 Tests 471 € acr human
AM26145PU-N anti-CD99 / MIC2 Antibody 0,1 mg 355 € acr human
AM31245AF-N anti-CD99 / MIC2 Antibody 0,2 mg 442 € acr human
AM31245PU-N anti-CD99 / MIC2 Antibody 2ml (200T) 413 € acr human
AM31245RP-N anti-CD99 / MIC2 Antibody 1ml (100T) 471 € acr human
AM33250SU-L anti-CD99 / MIC2 Antibody 1,0 ml 572 € acr human
AM33250SU-N anti-CD99 / MIC2 Antibody 0,5 ml 471 € acr human
AM33250SU-S anti-CD99 / MIC2 Antibody 0,1 ml 268 € acr human
AM33346SU-L anti-CD99 / MIC2 Antibody 1,0 ml 572 € acr human
AM33346SU-N anti-CD99 / MIC2 Antibody 0,5 ml 471 € acr human
AM33346SU-S anti-CD99 / MIC2 Antibody 0,1 ml 268 € acr human
AP15457PU-M anti-CD99 / MIC2 Antibody 0,5 ml 485 € acr human
AP15457PU-N anti-CD99 / MIC2 Antibody 1 ml 688 € acr human
AP15457PU-S anti-CD99 / MIC2 Antibody 0,1 ml 297 € acr human
C12164-1 anti-CD99 / MIC2 Antibody 50 Вµg 347 € acr human