| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CD99 is produced by our Mammalian expression system and the target gene encoding Asp23-Asp122 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
11, 13 kD |
| UniProt number: |
P14209 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
MIC2 (C-6His), CD99 |
| Short name: |
MIC2 (C-6His), Recombinant CD99 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
MIC2 (C-6His), sapiens CD99 molecule, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD99 and IDBG-40790 and ENSG00000002586 and 4267, CD99 and IDBG-639094 and ENSBTAG00000008114 and, HBA71 and MIC2 and MIC2X and MIC2Y and MSK5X, Plasma membranes, this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process, CD99 molecule |
| Identity: |
7082 |
| Gene: |
CD99 |
More about : CD99 |
| Long gene name: |
CD99 molecule |
| Synonyms gene: |
MIC2 |
| Synonyms gene name: |
F21 and O13 CD99 antigen , antigen identified by monoclonal antibodies 12E7 |
| Locus: |
Xp22, 3 , 32 and Yp11 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M16279 |
| Entrez gene record: |
4267 |
| RefSeq identity: |
NM_001122898 |
| Classification: |
CD molecules Pseudoautosomal region 1 |
| Havana BLAST/BLAT: |
OTTHUMG00000021073 |
| Locus Specific Databases: |
Mental Retardation database LRG_1023 |