| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CD99 is produced by our Mammalian expression system and the target gene encoding Asp23-Asp122 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
2 kD, 37 |
| UniProt number: |
P14209 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
MIC2 (C-Fc), CD99 |
| Short name: |
MIC2 (C-Fc), Recombinant CD99 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
MIC2 (C-fragment c), sapiens CD99 molecule, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD99 and IDBG-40790 and ENSG00000002586 and 4267, CD99 and IDBG-639094 and ENSBTAG00000008114 and, HBA71 and MIC2 and MIC2X and MIC2Y and MSK5X, Plasma membranes, this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process, CD99 molecule |
| Identity: |
7082 |
| Gene: |
CD99 |
More about : CD99 |
| Long gene name: |
CD99 molecule |
| Synonyms gene: |
MIC2 |
| Synonyms gene name: |
F21 and O13 CD99 antigen , antigen identified by monoclonal antibodies 12E7 |
| Locus: |
Xp22, 3 , 32 and Yp11 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M16279 |
| Entrez gene record: |
4267 |
| RefSeq identity: |
NM_001122898 |
| Classification: |
CD molecules Pseudoautosomal region 1 |
| Havana BLAST/BLAT: |
OTTHUMG00000021073 |
| Locus Specific Databases: |
Mental Retardation database LRG_1023 |