| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Fc gamma RIIIA is produced by our Mammalian expression system and the target gene encoding Gly17-Gln208 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
22, 61 kD |
| UniProt number: |
P08637 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD16a (C-6His), FCGR3A, RIIIA, Fc &gamma |
| Short name: |
CD16a (C-6His), FCGR3A, RIIIA, Recombinant Fc &gamma |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
CD16a (C-6His), RIIIA, fragment c fragment on Immunoglobulin G, low affinity IIIa, receptor (CD16a), sapiens fragment c &gamma, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD16 and CD16A and FCG3 and FCGR3 and FCGRIII and FCR-10 and FCRIII and FCRIIIA and IGFR3 and IMD20, Cell surfaces, FCGR3A and IDBG-104292 and ENSG00000203747 and 2214, IgG binding, low affinity IIIa, receptor (CD16a), this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019864 and IgG binding and molecular function this GO :0038096 and Fc-gamma receptor signaling pathway involved in pha this GO cytosis and biological process this GO :0045087 and innate immune response and biological process this GO :0050776 and regulation of immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0019864 : IgG binding, this GO :0019864 : IgG binding, Fc fragment of IgG |
| Identity: |
3619 |
| Gene: |
FCGR3A |
More about : FCGR3A |
| Long gene name: |
Fc fragment of IgG receptor IIIa |
| Synonyms gene: |
FCGR3 FCG3 |
| Synonyms gene name: |
Fc fragment of IgG, low affinity IIIa, low affinity IIIa, receptor (CD16a) , receptor for (CD16) Fc fragment of IgG |
| Synonyms: |
CD16 CD16a |
| Synonyms name: |
Fc gamma receptor IIIa |
| Locus: |
1q23, 3 |
| Discovery year: |
1988-11-30 |
| GenBank acession: |
BC036723 |
| Entrez gene record: |
2214 |
| Pubmed identfication: |
2139735 |
| RefSeq identity: |
NM_000569 |
| Classification: |
CD molecules Immunoglobulin like domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000034466 |
| Locus Specific Databases: |
FCGR3Abase: Mutation registry for Natural killer cell deficiency LRG_60 |