| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Fc gamma RIIIA is produced by our Mammalian expression system and the target gene encoding Gly17-Gln208(Val176Phe) is expressed fused with a 6His tag at the C-terminus |
| Molecular Weight: |
22, 7 kD |
| UniProt number: |
P08637 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD16a (C-6His, FCGR3A, RIIIA, Fc &gamma, Val176Phe) |
| Short name: |
CD16a (C-6His, FCGR3A, RIIIA, Recombinant Fc &gamma, Val176Phe) |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
CD16a (C-6His, RIIIA, fragment c fragment on Immunoglobulin G, low affinity IIIa, receptor (CD16a), sapiens fragment c &gamma, Val176Phe), recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD16 and CD16A and FCG3 and FCGR3 and FCGRIII and FCR-10 and FCRIII and FCRIIIA and IGFR3 and IMD20, Cell surfaces, FCGR3A and IDBG-104292 and ENSG00000203747 and 2214, IgG binding, low affinity IIIa, receptor (CD16a), this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019864 and IgG binding and molecular function this GO :0038096 and Fc-gamma receptor signaling pathway involved in pha this GO cytosis and biological process this GO :0045087 and innate immune response and biological process this GO :0050776 and regulation of immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0019864 : IgG binding, this GO :0019864 : IgG binding, Fc fragment of IgG |
| Identity: |
3619 |
| Gene: |
FCGR3A |
More about : FCGR3A |
| Long gene name: |
Fc fragment of IgG receptor IIIa |
| Synonyms gene: |
FCGR3 FCG3 |
| Synonyms gene name: |
Fc fragment of IgG, low affinity IIIa, low affinity IIIa, receptor (CD16a) , receptor for (CD16) Fc fragment of IgG |
| Synonyms: |
CD16 CD16a |
| Synonyms name: |
Fc gamma receptor IIIa |
| Locus: |
1q23, 3 |
| Discovery year: |
1988-11-30 |
| GenBank acession: |
BC036723 |
| Entrez gene record: |
2214 |
| Pubmed identfication: |
2139735 |
| RefSeq identity: |
NM_000569 |
| Classification: |
CD molecules Immunoglobulin like domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000034466 |
| Locus Specific Databases: |
FCGR3Abase: Mutation registry for Natural killer cell deficiency LRG_60 |