Recombinant Human HVEM, TNFRSF14, CD270 (C-6His)

Contact us
Catalog number: C418
Price: 263 €
Supplier: Bioss Primary Unconjugated Antibodies
Product name: Recombinant Human HVEM, TNFRSF14, CD270 (C-6His)
Quantity: 0.1ml
Other quantities: 1 mg 963€ 10 µg 100€ 50 µg 171€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 14/TNFRSF14 is produced by our Mammalian expression system and the target gene encoding Leu39-Val202 is expressed with a 6His tag at the C-terminus
Molecular Weight: 18, 38 kD
UniProt number: Q92956
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD270 (C-6His), TNFRSF14, HVEM
Short name: CD270 (C-6His), TNFRSF14, Recombinant HVEM
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD270 (C-6His), member 14, sapiens HVEM, tumor necrosis factor receptor superfamily, recombinant H
Alternative technique: rec
Alternative to gene target: ATAR and CD270 and HVEA and HVEM and LIGHTR and TR2, Cell surfaces, TNFRSF14 and IDBG-86399 and ENSG00000157873 and 8764, Tnfrsf14 and IDBG-207237 and ENSMUSG00000042333 and 230979, member 14, this GO :0001618 and virus receptor activity and molecular function this GO :0002741 and positive regulation of cytokine secretion involved in immune response and biological process this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009615 and response to virus and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031295 and T cell costimulation and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0046642 and negative regulation of alpha-beta T cell proliferation and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050829 and defense response to Gram-negative bacterium and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :2000406 and positive regulation of T cell migration and biological process, this GO :0001618 : virus receptor activity, this GO :0001618 : virus receptor activity and also this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding and also this GO :0031625 : ubiquitin protein ligase binding, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005515 : protein binding, this GO :0031625 : ubiquitin protein ligase binding, ubiquitin protein ligase binding, tumor necrosis factor receptor superfamily
Identity: 11912
Gene: TNFRSF14 | More about : TNFRSF14
Long gene name: TNF receptor superfamily member 14
Synonyms gene name: member 14 , member 14 (herpesvirus entry mediator) tumor necrosis factor receptor superfamily, tumor necrosis factor receptor superfamily
Synonyms: HVEM ATAR TR2 LIGHTR HVEA CD270
Synonyms name: herpesvirus entry mediator
Locus: 1p36, 32
Discovery year: 1998-12-04
GenBank acession: U70321
Entrez gene record: 8764
Pubmed identfication: 8898196 9162061
Classification: CD molecules Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000000792

Related Products :

C418 Recombinant Human HVEM, TNFRSF14, CD270 (C-6His) 1 mg 963 € novo human
CJ90 Recombinant Mouse HVEM, TNFRSF14, TR2, CD270 (C-Fc) 10 µg 100 € novo mouse
MBS241338 Anti-Human TNFRSF14 / CD270 / HVEM 50ug 597 € MBS Polyclonals_1 human
MBS240309 Anti-Human TNFRSF14 / CD270 / HVEM Antibody 50ug 597 € MBS Polyclonals_1 human
MBS621808 TNFRSF14, NT (TNF Receptor-like 2, ATAR, CD270, Herpesvirus Entry Mediator A, HVEA, Herpesvirus Entry Mediator, HVEM, LIGHTR, TR2, Tumor Necrosis Factor Receptor Superfamily Member 14) Antibody 100ug 730 € MBS Polyclonals_1 human
MBS620023 TNFSF14, CT (LIGHT, TNF Receptor-like 2, ATAR, CD270, Herpesvirus Entry Mediator A, HVEA, Herpesvirus Entry Mediator, HVEM, Herpesvirus Entry Mediator Ligand, TR2, Tumor Necrosis Factor Receptor Superfamily Member 14, TNFRSF14) Antibody 100ug 730 € MBS Polyclonals_1 human
MBS622870 TNFSF14 (LIGHT, TNF Receptor-like 2, ATAR, CD270, Herpesvirus Entry Mediator A, HVEA, Herpesvirus Entry Mediator, HVEM, TR2, Tumor Necrosis Factor Receptor Superfamily Member 14, TNFRSF14) Antibody 100ug 735 € MBS Polyclonals_1 human
RP-0811H Recombinant Human HVEM / TNFRSF14 Protein (His & Fc Tag) 100μg 508 € adv human
RP-0810H Recombinant Human HVEM / TNFRSF14 Protein (His Tag) 100μg 659 € adv human
RP-1329M Recombinant Mouse HVEM / TNFRSF14 Protein (His & Fc Tag) 100μg 688 € adv mouse
AR51263PU-N anti-TNFRSF14 / HVEM (39-202, His-tag) Antibody 0,5 mg 1109 € acr human
AR51263PU-S anti-TNFRSF14 / HVEM (39-202, His-tag) Antibody 0,1 mg 485 € acr human
AP05251PU-N anti-TNFRSF14 / HVEM Antibody 0,1 mg 688 € acr human
AP07375PU-N anti-TNFRSF14 / HVEM Antibody 50 Вµg 732 € acr human
AP07795PU-N anti-TNFRSF14 / HVEM Antibody 50 Вµg 732 € acr human
AP54309PU-N anti-TNFRSF14 / HVEM (Center) Antibody 0,4 ml 587 € acr human
AP30923CP-N anti-TNFRSF14 / HVEM Control Peptide Antibody 50 Вµg 282 € acr human
AP30924CP-N anti-TNFRSF14 / HVEM Control Peptide Antibody 50 Вµg 282 € acr human
AR00009PU-N anti-TNFRSF14 / HVEM (Fc Chimera) Antibody 0,1 mg 384 € acr human
AR00009PU-S anti-TNFRSF14 / HVEM (Fc Chimera) Antibody 20 Вµg 253 € acr human
AP05252PU-N anti-TNFRSF14 / HVEM (N-term) Antibody 0,1 mg 688 € acr human
GENTAUR-58be60ac9acb7 Anti-TNFRSF14/HVEM (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
R32572 LIGHTR Antibody / TNFRSF14 / HVEM 0.1mg 406 € NJS poly human
bs-2457R-A350 TNFRSF14/HVEM Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2457R-A488 TNFRSF14/HVEM Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2457R-A555 TNFRSF14/HVEM Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2457R-A594 TNFRSF14/HVEM Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2457R-A647 TNFRSF14/HVEM Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2457R-Biotin TNFRSF14/HVEM Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-2457R TNFRSF14/HVEM Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human