Recombinant Mouse HVEM, TNFRSF14, TR2, CD270 (C-Fc)

Contact us
Catalog number: CJ90
Price: 333 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Mouse HVEM, TNFRSF14, TR2, CD270 (C-Fc)
Quantity: 0.1ml
Other quantities: 1 mg 1115€ 50 µg 156€ 500 µg 709€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Herpesvirus Entry Mediator is produced by our Mammalian expression system and the target gene encoding Gln39-Val207 is expressed with a Fc tag at the C-terminus
Molecular Weight: 45, 6 kD
UniProt number: Q80WM9
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD270 (C-Fc), TNFRSF14, TR2, HVEM
Short name: CD270 (C-Fc), TNFRSF14, TR2, Recombinant Mouse HVEM
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD270 (C-fragment c), TR2, member 14, tumor necrosis factor receptor superfamily, recombinant Mouse HVEM
Alternative technique: rec
Alternative to gene target: ATAR and CD270 and HVEA and HVEM and LIGHTR and TR2, Cell surfaces, TNFRSF14 and IDBG-86399 and ENSG00000157873 and 8764, Tnfrsf14 and IDBG-207237 and ENSMUSG00000042333 and 230979, member 14, this GO :0001618 and virus receptor activity and molecular function this GO :0002741 and positive regulation of cytokine secretion involved in immune response and biological process this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009615 and response to virus and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031295 and T cell costimulation and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0046642 and negative regulation of alpha-beta T cell proliferation and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050829 and defense response to Gram-negative bacterium and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :2000406 and positive regulation of T cell migration and biological process, this GO :0001618 : virus receptor activity, this GO :0001618 : virus receptor activity and also this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding and also this GO :0031625 : ubiquitin protein ligase binding, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005515 : protein binding, this GO :0031625 : ubiquitin protein ligase binding, ubiquitin protein ligase binding, tumor necrosis factor receptor superfamily
Identity: 11912
Gene: TNFRSF14 | More about : TNFRSF14
Long gene name: TNF receptor superfamily member 14
Synonyms gene name: member 14 , member 14 (herpesvirus entry mediator) tumor necrosis factor receptor superfamily, tumor necrosis factor receptor superfamily
Synonyms: HVEM ATAR TR2 LIGHTR HVEA CD270
Synonyms name: herpesvirus entry mediator
Locus: 1p36, 32
Discovery year: 1998-12-04
GenBank acession: U70321
Entrez gene record: 8764
Pubmed identfication: 8898196 9162061
Classification: CD molecules Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000000792

Related Products :

CJ90 Recombinant Mouse HVEM, TNFRSF14, TR2, CD270 (C-Fc) 10 µg 100 € novo mouse
MBS621808 TNFRSF14, NT (TNF Receptor-like 2, ATAR, CD270, Herpesvirus Entry Mediator A, HVEA, Herpesvirus Entry Mediator, HVEM, LIGHTR, TR2, Tumor Necrosis Factor Receptor Superfamily Member 14) Antibody 100ug 730 € MBS Polyclonals_1 human
MBS622870 TNFSF14 (LIGHT, TNF Receptor-like 2, ATAR, CD270, Herpesvirus Entry Mediator A, HVEA, Herpesvirus Entry Mediator, HVEM, TR2, Tumor Necrosis Factor Receptor Superfamily Member 14, TNFRSF14) Antibody 100ug 735 € MBS Polyclonals_1 human
C418 Recombinant Human HVEM, TNFRSF14, CD270 (C-6His) 1 mg 963 € novo human
MBS241338 Anti-Human TNFRSF14 / CD270 / HVEM 50ug 597 € MBS Polyclonals_1 human
MBS240309 Anti-Human TNFRSF14 / CD270 / HVEM Antibody 50ug 597 € MBS Polyclonals_1 human
MBS620023 TNFSF14, CT (LIGHT, TNF Receptor-like 2, ATAR, CD270, Herpesvirus Entry Mediator A, HVEA, Herpesvirus Entry Mediator, HVEM, Herpesvirus Entry Mediator Ligand, TR2, Tumor Necrosis Factor Receptor Superfamily Member 14, TNFRSF14) Antibody 100ug 730 € MBS Polyclonals_1 human
RP-1329M Recombinant Mouse HVEM / TNFRSF14 Protein (His & Fc Tag) 100μg 688 € adv mouse
MBS420202 Goat anti-HVEM / TR2 Antibody 100ug 370 € MBS Polyclonals_1 human
RP-0811H Recombinant Human HVEM / TNFRSF14 Protein (His & Fc Tag) 100μg 508 € adv human
RP-0810H Recombinant Human HVEM / TNFRSF14 Protein (His Tag) 100μg 659 € adv human
AR51263PU-N anti-TNFRSF14 / HVEM (39-202, His-tag) Antibody 0,5 mg 1109 € acr human
AR51263PU-S anti-TNFRSF14 / HVEM (39-202, His-tag) Antibody 0,1 mg 485 € acr human
AP05251PU-N anti-TNFRSF14 / HVEM Antibody 0,1 mg 688 € acr human
AP07375PU-N anti-TNFRSF14 / HVEM Antibody 50 Вµg 732 € acr human
AP07795PU-N anti-TNFRSF14 / HVEM Antibody 50 Вµg 732 € acr human
AP54309PU-N anti-TNFRSF14 / HVEM (Center) Antibody 0,4 ml 587 € acr human
AP30923CP-N anti-TNFRSF14 / HVEM Control Peptide Antibody 50 Вµg 282 € acr human
AP30924CP-N anti-TNFRSF14 / HVEM Control Peptide Antibody 50 Вµg 282 € acr human
AR00009PU-N anti-TNFRSF14 / HVEM (Fc Chimera) Antibody 0,1 mg 384 € acr human
AR00009PU-S anti-TNFRSF14 / HVEM (Fc Chimera) Antibody 20 Вµg 253 € acr human
AP05252PU-N anti-TNFRSF14 / HVEM (N-term) Antibody 0,1 mg 688 € acr human
GENTAUR-58be60ac9acb7 Anti-TNFRSF14/HVEM (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
R32572 LIGHTR Antibody / TNFRSF14 / HVEM 0.1mg 406 € NJS poly human
bs-2457R-A350 TNFRSF14/HVEM Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2457R-A488 TNFRSF14/HVEM Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2457R-A555 TNFRSF14/HVEM Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2457R-A594 TNFRSF14/HVEM Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2457R-A647 TNFRSF14/HVEM Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2457R-Biotin TNFRSF14/HVEM Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human