| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Herpesvirus Entry Mediator is produced by our Mammalian expression system and the target gene encoding Gln39-Val207 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
45, 6 kD |
| UniProt number: |
Q80WM9 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CD270 (C-Fc), TNFRSF14, TR2, HVEM |
| Short name: |
CD270 (C-Fc), TNFRSF14, TR2, Recombinant Mouse HVEM |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
CD270 (C-fragment c), TR2, member 14, tumor necrosis factor receptor superfamily, recombinant Mouse HVEM |
| Alternative technique: |
rec |
| Alternative to gene target: |
ATAR and CD270 and HVEA and HVEM and LIGHTR and TR2, Cell surfaces, TNFRSF14 and IDBG-86399 and ENSG00000157873 and 8764, Tnfrsf14 and IDBG-207237 and ENSMUSG00000042333 and 230979, member 14, this GO :0001618 and virus receptor activity and molecular function this GO :0002741 and positive regulation of cytokine secretion involved in immune response and biological process this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009615 and response to virus and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031295 and T cell costimulation and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0046642 and negative regulation of alpha-beta T cell proliferation and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050829 and defense response to Gram-negative bacterium and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :2000406 and positive regulation of T cell migration and biological process, this GO :0001618 : virus receptor activity, this GO :0001618 : virus receptor activity and also this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding and also this GO :0031625 : ubiquitin protein ligase binding, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005515 : protein binding, this GO :0031625 : ubiquitin protein ligase binding, ubiquitin protein ligase binding, tumor necrosis factor receptor superfamily |
| Identity: |
11912 |
| Gene: |
TNFRSF14 |
More about : TNFRSF14 |
| Long gene name: |
TNF receptor superfamily member 14 |
| Synonyms gene name: |
member 14 , member 14 (herpesvirus entry mediator) tumor necrosis factor receptor superfamily, tumor necrosis factor receptor superfamily |
| Synonyms: |
HVEM ATAR TR2 LIGHTR HVEA CD270 |
| Synonyms name: |
herpesvirus entry mediator |
| Locus: |
1p36, 32 |
| Discovery year: |
1998-12-04 |
| GenBank acession: |
U70321 |
| Entrez gene record: |
8764 |
| Pubmed identfication: |
8898196 9162061 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000000792 |