| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 14/TNFRSF14 is produced by our Mammalian expression system and the target gene encoding Leu39-Val202 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
18, 38 kD |
| UniProt number: |
Q92956 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD270 (C-6His), TNFRSF14, HVEM |
| Short name: |
CD270 (C-6His), TNFRSF14, Recombinant HVEM |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD270 (C-6His), member 14, sapiens HVEM, tumor necrosis factor receptor superfamily, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ATAR and CD270 and HVEA and HVEM and LIGHTR and TR2, Cell surfaces, TNFRSF14 and IDBG-86399 and ENSG00000157873 and 8764, Tnfrsf14 and IDBG-207237 and ENSMUSG00000042333 and 230979, member 14, this GO :0001618 and virus receptor activity and molecular function this GO :0002741 and positive regulation of cytokine secretion involved in immune response and biological process this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009615 and response to virus and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031295 and T cell costimulation and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0046642 and negative regulation of alpha-beta T cell proliferation and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050829 and defense response to Gram-negative bacterium and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :2000406 and positive regulation of T cell migration and biological process, this GO :0001618 : virus receptor activity, this GO :0001618 : virus receptor activity and also this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding and also this GO :0031625 : ubiquitin protein ligase binding, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005515 : protein binding, this GO :0031625 : ubiquitin protein ligase binding, ubiquitin protein ligase binding, tumor necrosis factor receptor superfamily |
| Identity: |
11912 |
| Gene: |
TNFRSF14 |
More about : TNFRSF14 |
| Long gene name: |
TNF receptor superfamily member 14 |
| Synonyms gene name: |
member 14 , member 14 (herpesvirus entry mediator) tumor necrosis factor receptor superfamily, tumor necrosis factor receptor superfamily |
| Synonyms: |
HVEM ATAR TR2 LIGHTR HVEA CD270 |
| Synonyms name: |
herpesvirus entry mediator |
| Locus: |
1p36, 32 |
| Discovery year: |
1998-12-04 |
| GenBank acession: |
U70321 |
| Entrez gene record: |
8764 |
| Pubmed identfication: |
8898196 9162061 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000000792 |